BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0130 (428 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g13784.1 68416.m01741 beta-fructosidase, putative / beta-fruc... 32 0.19 At4g38360.2 68417.m05424 expressed protein contains Pfam profile... 30 0.58 At5g63260.1 68418.m07940 zinc finger (CCCH-type) family protein ... 27 7.1 At2g29120.1 68415.m03539 glutamate receptor family protein (GLR2... 27 7.1 At2g16360.1 68415.m01872 40S ribosomal protein S25 (RPS25A) 27 7.1 At1g55120.1 68414.m06295 beta-fructosidase, putative / beta-fruc... 27 7.1 At4g10210.1 68417.m01674 hypothetical protein IB1C3-1 protein, A... 26 9.4 At3g55290.2 68416.m06141 short-chain dehydrogenase/reductase (SD... 26 9.4 At3g55290.1 68416.m06140 short-chain dehydrogenase/reductase (SD... 26 9.4 At2g29130.1 68415.m03541 laccase, putative / diphenol oxidase, p... 26 9.4 >At3g13784.1 68416.m01741 beta-fructosidase, putative / beta-fructofuranosidase, putative / cell wall invertase, putative similar to beta-fructofuranosidase GI:402740 from [Arabidopsis thaliana] Length = 569 Score = 31.9 bits (69), Expect = 0.19 Identities = 14/44 (31%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Frame = +1 Query: 250 WAHARYTEGISMFSL--A*RPGQPAETPSCWGLGFAIIPHKRGI 375 W HA T+ I+ +L A RP +P++ CW I+P+ + + Sbjct: 85 WGHATSTDLINWITLSPAIRPSRPSDINGCWSGSVTILPNGKPV 128 >At4g38360.2 68417.m05424 expressed protein contains Pfam profile PF03619: Domain of unknown function Length = 485 Score = 30.3 bits (65), Expect = 0.58 Identities = 20/55 (36%), Positives = 27/55 (49%) Frame = -3 Query: 357 DNCKPQSPARRSFSGLPGPLGQGEHADSFSVARVRPGHLRASQTCYCSISCGSKT 193 D+C SP+RR G+ PL G +DS V R + H R S Y S G ++ Sbjct: 415 DSCMSSSPSRRVIRGIDDPLLNGSFSDS-GVTRTKK-HRRKSG--YTSAESGGES 465 >At5g63260.1 68418.m07940 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 435 Score = 26.6 bits (56), Expect = 7.1 Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = -3 Query: 378 RNSSF-MGDNCKPQSPARRSFSGLPGPLGQGEHADSFS 268 RN S G +CK P + G+ PL +G + SFS Sbjct: 205 RNGSCKFGSDCKFNHPDPTAIGGVDSPLYRGNNGGSFS 242 >At2g29120.1 68415.m03539 glutamate receptor family protein (GLR2.7) plant glutamate receptor family, PMID:11379626 Length = 926 Score = 26.6 bits (56), Expect = 7.1 Identities = 17/41 (41%), Positives = 23/41 (56%) Frame = +1 Query: 31 GGAWPFLVGGAICLVNSGNERDSSLLNRRRYLGVRGLVSRN 153 G W L G + L+ S NER SSL N + LGVR + ++ Sbjct: 231 GYVW-LLTDGVMNLLKS-NERGSSLENMQGVLGVRSHIPKS 269 >At2g16360.1 68415.m01872 40S ribosomal protein S25 (RPS25A) Length = 125 Score = 26.6 bits (56), Expect = 7.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -2 Query: 64 SLHQLRTAMHHHPPNQERAV 5 S HQ RT HHHP N V Sbjct: 19 SRHQRRTKSHHHPLNPPNPV 38 >At1g55120.1 68414.m06295 beta-fructosidase, putative / beta-fructofuranosidase, putative similar to beta-fructofuranosidase GI:402740 Length = 594 Score = 26.6 bits (56), Expect = 7.1 Identities = 11/44 (25%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = +1 Query: 250 WAHARYTEGISMFSL--A*RPGQPAETPSCWGLGFAIIPHKRGI 375 W H+ + ++ S A P QP++ CW I+P+ + + Sbjct: 83 WGHSTSVDLVNWISQPPAFNPSQPSDINGCWSGSVTILPNGKPV 126 >At4g10210.1 68417.m01674 hypothetical protein IB1C3-1 protein, Arabidopsis thaliana, AJ011845 contains Pfam profile PF03080: Arabidopsis proteins of unknown function Length = 375 Score = 26.2 bits (55), Expect = 9.4 Identities = 18/50 (36%), Positives = 23/50 (46%) Frame = -3 Query: 387 ALTRNSSFMGDNCKPQSPARRSFSGLPGPLGQGEHADSFSVARVRPGHLR 238 AL + SF GDN PQS +++ P G H F+V R G R Sbjct: 141 ALLKMKSFDGDNSNPQSSWSKTYK--PTSSNGGHH---FAVVRTTKGKPR 185 >At3g55290.2 68416.m06141 short-chain dehydrogenase/reductase (SDR) family protein contains similarity to 3-oxoacyl-[acyl-carrier protein] reductase SP:P51831 from [Bacillus subtilis] Length = 279 Score = 26.2 bits (55), Expect = 9.4 Identities = 10/34 (29%), Positives = 20/34 (58%) Frame = +1 Query: 43 PFLVGGAICLVNSGNERDSSLLNRRRYLGVRGLV 144 P+LV +C++ +R S++N G+RG++ Sbjct: 136 PWLVSKHVCMLMRDAKRGGSVINISSIAGIRGML 169 >At3g55290.1 68416.m06140 short-chain dehydrogenase/reductase (SDR) family protein contains similarity to 3-oxoacyl-[acyl-carrier protein] reductase SP:P51831 from [Bacillus subtilis] Length = 280 Score = 26.2 bits (55), Expect = 9.4 Identities = 10/34 (29%), Positives = 20/34 (58%) Frame = +1 Query: 43 PFLVGGAICLVNSGNERDSSLLNRRRYLGVRGLV 144 P+LV +C++ +R S++N G+RG++ Sbjct: 137 PWLVSKHVCMLMRDAKRGGSVINISSIAGIRGML 170 >At2g29130.1 68415.m03541 laccase, putative / diphenol oxidase, putative similar to laccase [Liriodendron tulipifera][GI:1621467] Length = 573 Score = 26.2 bits (55), Expect = 9.4 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -3 Query: 345 PQSPARRSFSGLPGPLGQGEHADSFSVARVRPG 247 P + +F+GLPGPL D++ + V+PG Sbjct: 189 PNASDAHTFNGLPGPLYNCSTKDTYKL-MVKPG 220 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,252,233 Number of Sequences: 28952 Number of extensions: 178833 Number of successful extensions: 414 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 407 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 414 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 675111616 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -