BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0129 (598 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe... 27 2.1 SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|c... 27 2.7 SPAC1782.09c |clp1|flp1|Cdc14-related protein phosphatase Clp1/F... 27 2.7 SPAC29B12.08 |||sequence orphan|Schizosaccharomyces pombe|chr 1|... 26 4.8 SPAC23A1.09 |||RNA-binding protein|Schizosaccharomyces pombe|chr... 26 4.8 SPCC1393.04 |fta4|sma6|Sim4 and Mal2 associated |Schizosaccharom... 25 6.3 SPBP35G2.11c |||transcription related zf-ZZ type zinc finger pro... 25 6.3 SPCP31B10.07 |eft202||translation elongation factor 2 |Schizosac... 25 8.4 SPAC513.01c |eft201|eft2-1, etf2, SPAPYUK71.04c|translation elon... 25 8.4 >SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 410 Score = 27.1 bits (57), Expect = 2.1 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -1 Query: 577 ARKIRGRPENAGPDPVRNVRRFSE 506 AR I GRPEN G ++N+ R S+ Sbjct: 214 ARTIPGRPENGGNCDIKNLSRGSK 237 >SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1142 Score = 26.6 bits (56), Expect = 2.7 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +1 Query: 394 SGCGRCRVWSMFVRNVRFSE 453 +GCG+ VW +VR V F E Sbjct: 108 NGCGKSYVWPSYVRFVDFDE 127 >SPAC1782.09c |clp1|flp1|Cdc14-related protein phosphatase Clp1/Flp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 537 Score = 26.6 bits (56), Expect = 2.7 Identities = 15/40 (37%), Positives = 24/40 (60%) Frame = -1 Query: 256 GTNRRDISTYIPHLNFQGPQRVSGHRRKCGALRVPNHISL 137 GT++ +IST +P P++VSGH A R+P+ S+ Sbjct: 374 GTSQSNISTPLPEPTPGQPRKVSGHNPP-SARRLPSASSV 412 >SPAC29B12.08 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 682 Score = 25.8 bits (54), Expect = 4.8 Identities = 23/83 (27%), Positives = 33/83 (39%), Gaps = 9/83 (10%) Frame = -1 Query: 556 PENAGPDPVRNVRRFSECHIKYIQFLXPHYIKI--------LTR*NEHYARTS-TRPGTG 404 P + PDPV + S H+ PH+ + T + H A +S T P +G Sbjct: 158 PISTLPDPVATISSSSSSHLDMGAIHPPHHSSLPPHMGVDPSTMADAHNAHSSLTPPQSG 217 Query: 403 RIRFPSKPDTPRSSEPILIPKLR 335 + S P P +P IP R Sbjct: 218 ---YSSMPSLPYLQQPFQIPSQR 237 >SPAC23A1.09 |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 121 Score = 25.8 bits (54), Expect = 4.8 Identities = 16/47 (34%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = -3 Query: 173 MRCSSRSEPYLPSI-GFHGTRTLRQKRKLFPDLSAASSGHFGLPRRT 36 MR + E Y+ + G H T Q LF D + H L RRT Sbjct: 1 MRPAKSVEGYIIIVTGVHPEATEEQVEDLFADFGPVKNLHLNLDRRT 47 >SPCC1393.04 |fta4|sma6|Sim4 and Mal2 associated |Schizosaccharomyces pombe|chr 3|||Manual Length = 233 Score = 25.4 bits (53), Expect = 6.3 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -3 Query: 431 TNIDQTRHRPHPLPVQTRHAPV 366 +N+D + PHP P Q PV Sbjct: 100 SNLDSVKSLPHPWPFQKESRPV 121 >SPBP35G2.11c |||transcription related zf-ZZ type zinc finger protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 397 Score = 25.4 bits (53), Expect = 6.3 Identities = 15/49 (30%), Positives = 18/49 (36%) Frame = -3 Query: 272 DLLRIWYEPARHLHVHPSPEFSRSAESIRTPPQMRCSSRSEPYLPSIGF 126 D+ R Y LH P P F SI + + CS S P F Sbjct: 83 DVCRDCYAKQAFLHPCPKPHFVLVRSSIPSVASLTCSVNSMSVSPQSNF 131 >SPCP31B10.07 |eft202||translation elongation factor 2 |Schizosaccharomyces pombe|chr 3|||Manual Length = 842 Score = 25.0 bits (52), Expect = 8.4 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +2 Query: 32 RVFDGVTQSGLKTPPRGPGRV 94 RVF G +SGLK +GP V Sbjct: 399 RVFSGTVRSGLKVRIQGPNYV 419 >SPAC513.01c |eft201|eft2-1, etf2, SPAPYUK71.04c|translation elongation factor 2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 842 Score = 25.0 bits (52), Expect = 8.4 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +2 Query: 32 RVFDGVTQSGLKTPPRGPGRV 94 RVF G +SGLK +GP V Sbjct: 399 RVFSGTVRSGLKVRIQGPNYV 419 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,533,362 Number of Sequences: 5004 Number of extensions: 52876 Number of successful extensions: 163 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 161 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 163 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 260219058 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -