BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0125 (751 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. 24 5.8 EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. 24 5.8 EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. 24 5.8 EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. 24 5.8 EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. 24 5.8 EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. 24 5.8 EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. 24 5.8 EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. 24 5.8 EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. 24 5.8 EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. 24 5.8 EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. 24 5.8 EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. 24 5.8 EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. 24 5.8 EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. 24 5.8 EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. 24 5.8 EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. 24 5.8 EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. 24 5.8 EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. 24 5.8 EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. 24 5.8 EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. 24 5.8 EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. 24 5.8 EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. 24 5.8 EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. 24 5.8 EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. 24 5.8 EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. 24 5.8 EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. 24 5.8 EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. 24 5.8 EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. 24 5.8 AY344813-1|AAR03841.1| 286|Anopheles gambiae LRR Toll protein. 24 5.8 AY344812-1|AAR03840.1| 286|Anopheles gambiae LRR Toll protein. 24 5.8 AY344811-1|AAR03839.1| 286|Anopheles gambiae LRR Toll protein. 24 5.8 AY344810-1|AAR03838.1| 286|Anopheles gambiae LRR Toll protein. 24 5.8 AY344809-1|AAR03837.1| 286|Anopheles gambiae LRR Toll protein. 24 5.8 AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylch... 23 7.6 >EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.8 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 233 SKVVNFDDLDNFCRSHGQVPATHLSNVCLINF 328 +K+ DLD CRS Q L+ + +NF Sbjct: 152 NKITMLRDLDEGCRSRVQYLDLKLNEIDTVNF 183 >EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.8 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 233 SKVVNFDDLDNFCRSHGQVPATHLSNVCLINF 328 +K+ DLD CRS Q L+ + +NF Sbjct: 152 NKITMLRDLDEGCRSRVQYLDLKLNEIDTVNF 183 >EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.8 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 233 SKVVNFDDLDNFCRSHGQVPATHLSNVCLINF 328 +K+ DLD CRS Q L+ + +NF Sbjct: 152 NKITMLRDLDEGCRSRVQYLDLKLNEIDTVNF 183 >EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.8 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 233 SKVVNFDDLDNFCRSHGQVPATHLSNVCLINF 328 +K+ DLD CRS Q L+ + +NF Sbjct: 152 NKITMLRDLDEGCRSRVQYLDLKLNEIDTVNF 183 >EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.8 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 233 SKVVNFDDLDNFCRSHGQVPATHLSNVCLINF 328 +K+ DLD CRS Q L+ + +NF Sbjct: 152 NKITMLRDLDEGCRSRVQYLDLKLNEIDTVNF 183 >EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.8 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 233 SKVVNFDDLDNFCRSHGQVPATHLSNVCLINF 328 +K+ DLD CRS Q L+ + +NF Sbjct: 152 NKITMLRDLDEGCRSRVQYLDLKLNEIDTVNF 183 >EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.8 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 233 SKVVNFDDLDNFCRSHGQVPATHLSNVCLINF 328 +K+ DLD CRS Q L+ + +NF Sbjct: 152 NKITMLRDLDEGCRSRVQYLDLKLNEIDTVNF 183 >EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.8 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 233 SKVVNFDDLDNFCRSHGQVPATHLSNVCLINF 328 +K+ DLD CRS Q L+ + +NF Sbjct: 152 NKITMLRDLDEGCRSRVQYLDLKLNEIDTVNF 183 >EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.8 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 233 SKVVNFDDLDNFCRSHGQVPATHLSNVCLINF 328 +K+ DLD CRS Q L+ + +NF Sbjct: 152 NKITMLRDLDEGCRSRVQYLDLKLNEIDTVNF 183 >EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.8 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 233 SKVVNFDDLDNFCRSHGQVPATHLSNVCLINF 328 +K+ DLD CRS Q L+ + +NF Sbjct: 152 NKITMLRDLDEGCRSRVQYLDLKLNEIDTVNF 183 >EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.8 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 233 SKVVNFDDLDNFCRSHGQVPATHLSNVCLINF 328 +K+ DLD CRS Q L+ + +NF Sbjct: 152 NKITMLRDLDEGCRSRVQYLDLKLNEIDTVNF 183 >EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 23.8 bits (49), Expect = 5.8 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 233 SKVVNFDDLDNFCRSHGQVPATHLSNVCLINF 328 +K+ DLD CRS Q L+ + +NF Sbjct: 152 NKITMLRDLDEGCRSRVQYLDLKLNEIDTVNF 183 >EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.8 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 233 SKVVNFDDLDNFCRSHGQVPATHLSNVCLINF 328 +K+ DLD CRS Q L+ + +NF Sbjct: 152 NKITMLRDLDEGCRSRVQYLDLKLNEIDTVNF 183 >EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 23.8 bits (49), Expect = 5.8 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 233 SKVVNFDDLDNFCRSHGQVPATHLSNVCLINF 328 +K+ DLD CRS Q L+ + +NF Sbjct: 152 NKITMLRDLDEGCRSRVQYLDLKLNEIDTVNF 183 >EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. Length = 499 Score = 23.8 bits (49), Expect = 5.8 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 233 SKVVNFDDLDNFCRSHGQVPATHLSNVCLINF 328 +K+ DLD CRS Q L+ + +NF Sbjct: 152 NKITMLRDLDEGCRSRVQYLDLKLNEIDTVNF 183 >EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.8 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 233 SKVVNFDDLDNFCRSHGQVPATHLSNVCLINF 328 +K+ DLD CRS Q L+ + +NF Sbjct: 152 NKITMLRDLDEGCRSRVQYLDLKLNEIDTVNF 183 >EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 23.8 bits (49), Expect = 5.8 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 233 SKVVNFDDLDNFCRSHGQVPATHLSNVCLINF 328 +K+ DLD CRS Q L+ + +NF Sbjct: 152 NKITMLRDLDEGCRSRVQYLDLKLNEIDTVNF 183 >EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.8 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 233 SKVVNFDDLDNFCRSHGQVPATHLSNVCLINF 328 +K+ DLD CRS Q L+ + +NF Sbjct: 152 NKITMLRDLDEGCRSRVQYLDLKLNEIDTVNF 183 >EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. Length = 500 Score = 23.8 bits (49), Expect = 5.8 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 233 SKVVNFDDLDNFCRSHGQVPATHLSNVCLINF 328 +K+ DLD CRS Q L+ + +NF Sbjct: 152 NKITMLRDLDEGCRSRVQYLDLKLNEIDTVNF 183 >EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.8 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 233 SKVVNFDDLDNFCRSHGQVPATHLSNVCLINF 328 +K+ DLD CRS Q L+ + +NF Sbjct: 152 NKITMLRDLDEGCRSRVQYLDLKLNEIDTVNF 183 >EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.8 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 233 SKVVNFDDLDNFCRSHGQVPATHLSNVCLINF 328 +K+ DLD CRS Q L+ + +NF Sbjct: 152 NKITMLRDLDEGCRSRVQYLDLKLNEIDTVNF 183 >EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 23.8 bits (49), Expect = 5.8 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 233 SKVVNFDDLDNFCRSHGQVPATHLSNVCLINF 328 +K+ DLD CRS Q L+ + +NF Sbjct: 152 NKITMLRDLDEGCRSRVQYLDLKLNEIDTVNF 183 >EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. Length = 448 Score = 23.8 bits (49), Expect = 5.8 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 233 SKVVNFDDLDNFCRSHGQVPATHLSNVCLINF 328 +K+ DLD CRS Q L+ + +NF Sbjct: 152 NKITMLRDLDEGCRSRVQYLDLKLNEIDTVNF 183 >EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 23.8 bits (49), Expect = 5.8 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 233 SKVVNFDDLDNFCRSHGQVPATHLSNVCLINF 328 +K+ DLD CRS Q L+ + +NF Sbjct: 152 NKITMLRDLDEGCRSRVQYLDLKLNEIDTVNF 183 >EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. Length = 421 Score = 23.8 bits (49), Expect = 5.8 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 233 SKVVNFDDLDNFCRSHGQVPATHLSNVCLINF 328 +K+ DLD CRS Q L+ + +NF Sbjct: 152 NKITMLRDLDEGCRSRVQYLDLKLNEIDTVNF 183 >EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 23.8 bits (49), Expect = 5.8 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 233 SKVVNFDDLDNFCRSHGQVPATHLSNVCLINF 328 +K+ DLD CRS Q L+ + +NF Sbjct: 152 NKITMLRDLDEGCRSRVQYLDLKLNEIDTVNF 183 >EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 23.8 bits (49), Expect = 5.8 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 233 SKVVNFDDLDNFCRSHGQVPATHLSNVCLINF 328 +K+ DLD CRS Q L+ + +NF Sbjct: 152 NKITMLRDLDEGCRSRVQYLDLKLNEIDTVNF 183 >EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 23.8 bits (49), Expect = 5.8 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 233 SKVVNFDDLDNFCRSHGQVPATHLSNVCLINF 328 +K+ DLD CRS Q L+ + +NF Sbjct: 152 NKITMLRDLDEGCRSRVQYLDLKLNEIDTVNF 183 >AY344813-1|AAR03841.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 23.8 bits (49), Expect = 5.8 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 233 SKVVNFDDLDNFCRSHGQVPATHLSNVCLINF 328 +K+ DLD CRS Q L+ + +NF Sbjct: 77 NKITMLRDLDEGCRSRVQYLDLKLNEIDTVNF 108 >AY344812-1|AAR03840.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 23.8 bits (49), Expect = 5.8 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 233 SKVVNFDDLDNFCRSHGQVPATHLSNVCLINF 328 +K+ DLD CRS Q L+ + +NF Sbjct: 77 NKITMLRDLDEGCRSRVQYLDLKLNEIDTVNF 108 >AY344811-1|AAR03839.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 23.8 bits (49), Expect = 5.8 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 233 SKVVNFDDLDNFCRSHGQVPATHLSNVCLINF 328 +K+ DLD CRS Q L+ + +NF Sbjct: 77 NKITMLRDLDEGCRSRVQYLDLKLNEIDTVNF 108 >AY344810-1|AAR03838.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 23.8 bits (49), Expect = 5.8 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 233 SKVVNFDDLDNFCRSHGQVPATHLSNVCLINF 328 +K+ DLD CRS Q L+ + +NF Sbjct: 77 NKITMLRDLDEGCRSRVQYLDLKLNEIDTVNF 108 >AY344809-1|AAR03837.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 23.8 bits (49), Expect = 5.8 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 233 SKVVNFDDLDNFCRSHGQVPATHLSNVCLINF 328 +K+ DLD CRS Q L+ + +NF Sbjct: 77 NKITMLRDLDEGCRSRVQYLDLKLNEIDTVNF 108 >AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylcholine receptor subunitbeta 1 protein. Length = 519 Score = 23.4 bits (48), Expect = 7.6 Identities = 30/121 (24%), Positives = 54/121 (44%), Gaps = 2/121 (1%) Frame = -3 Query: 440 RLLPSLDVVAVSQAPSPESNPD--SPLPVTTMVVAETTIES**GRHLKDASPVLDHAICK 267 RL +++ +S P P ++P SP + + A +S + + S L H CK Sbjct: 354 RLRWMMEMPGMSVPPQPHTHPSYGSPAEIPKHISALGAKQS--KMEVMELSD-LHHPNCK 410 Query: 266 SYPDHQN*RLXTRGPPSIGFDLIKALIPSLVRVLIACISSRITTVIQVTE*DLRNQN*YI 87 N +L + G IG D + S +L++ +S+ T ++ LRN++ YI Sbjct: 411 -----MNRKLNS-GDLGIGADSCRRESESSDSILLSPEASKATEAVEFIAEHLRNEDLYI 464 Query: 86 E 84 + Sbjct: 465 Q 465 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 776,815 Number of Sequences: 2352 Number of extensions: 16177 Number of successful extensions: 70 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 70 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 70 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77339358 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -