BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0125 (751 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 23 4.0 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 22 5.3 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 5.3 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 22 7.1 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 22 7.1 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 22 7.1 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 22 7.1 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 22 7.1 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 22 7.1 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 22 7.1 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 22.6 bits (46), Expect = 4.0 Identities = 15/45 (33%), Positives = 20/45 (44%) Frame = +1 Query: 43 MSQCKPY*GDTANGSIYQFWFLRSYSVTWITVVILELIHAIRTLT 177 M C P DT +Y+F R Y + T VI + + TLT Sbjct: 230 MYACCP--NDTYPMIVYEFSISRHYGILHATYVIPAVTMMLLTLT 272 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 22.2 bits (45), Expect = 5.3 Identities = 10/38 (26%), Positives = 19/38 (50%) Frame = +3 Query: 15 YACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYL 128 Y C + + LRR + ++++VP + +SYL Sbjct: 215 YPCCDEPYPDIFFNITLRRKTLFYTVNLIVPCVSISYL 252 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.2 bits (45), Expect = 5.3 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +1 Query: 421 SKEGSRRANYPLPARGGSDEK*RYG 495 +K S+ AN P PA GG + + G Sbjct: 1014 AKPQSQEANKPKPATGGKGTRPKRG 1038 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = -3 Query: 683 SPRMRCTDSAAHKCNYELFNRNNFSIRYWSWNY 585 S + S ++ NY +N NN+ ++ NY Sbjct: 76 SKEPKIISSLSNNYNYSNYNNNNYKQLCYNINY 108 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = -3 Query: 683 SPRMRCTDSAAHKCNYELFNRNNFSIRYWSWNY 585 S + S ++ NY +N NN+ ++ NY Sbjct: 76 SKEPKIISSLSNNYNYSNYNNNNYKQLCYNINY 108 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = -3 Query: 683 SPRMRCTDSAAHKCNYELFNRNNFSIRYWSWNY 585 S + S ++ NY +N NN+ ++ NY Sbjct: 76 SKEPKIISSLSNNYNYSNYNNNNYKQLCYNINY 108 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = -3 Query: 683 SPRMRCTDSAAHKCNYELFNRNNFSIRYWSWNY 585 S + S ++ NY +N NN+ ++ NY Sbjct: 76 SKEPKIISSLSNNYNYSNYNNNNYKQLCYNINY 108 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = -3 Query: 683 SPRMRCTDSAAHKCNYELFNRNNFSIRYWSWNY 585 S + S ++ NY +N NN+ ++ NY Sbjct: 76 SKEPKIISSLSNNYNYSNYNNNNYKQLCYNINY 108 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.8 bits (44), Expect = 7.1 Identities = 7/38 (18%), Positives = 21/38 (55%) Frame = +3 Query: 15 YACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYL 128 Y C + + ++ +RR + +++++P + +S+L Sbjct: 224 YTCCDEPYLDITFNITMRRKTLFYTVNIIIPCMGISFL 261 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.8 bits (44), Expect = 7.1 Identities = 7/38 (18%), Positives = 21/38 (55%) Frame = +3 Query: 15 YACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYL 128 Y C + + ++ +RR + +++++P + +S+L Sbjct: 224 YTCCDEPYLDITFNITMRRKTLFYTVNIIIPCMGISFL 261 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 207,723 Number of Sequences: 438 Number of extensions: 4632 Number of successful extensions: 21 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -