BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0122 (490 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain tran... 24 0.85 AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. 24 0.85 EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglu... 22 2.6 >AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain transcription factor Zen2 protein. Length = 243 Score = 23.8 bits (49), Expect = 0.85 Identities = 13/53 (24%), Positives = 24/53 (45%) Frame = +3 Query: 174 WDPKDGELCLVRSKSGETLMEDRSDSDCKSIVGTGYRGERLIEPSSSWFRPKF 332 ++P+ E+ L ++S E ME + T Y +L+E + R K+ Sbjct: 57 FEPQQFEVSLSENRSHEPEMERPKGASNGKRARTAYTSSQLVELEREFHRSKY 109 >AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. Length = 292 Score = 23.8 bits (49), Expect = 0.85 Identities = 13/53 (24%), Positives = 24/53 (45%) Frame = +3 Query: 174 WDPKDGELCLVRSKSGETLMEDRSDSDCKSIVGTGYRGERLIEPSSSWFRPKF 332 ++P+ E+ L ++S E ME + T Y +L+E + R K+ Sbjct: 77 FEPQQFEVSLSENRSHEPEMERPKGASNGKRARTAYTSSQLVELEREFHRSKY 129 >EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglucosaminidase NAG1 protein. Length = 598 Score = 22.2 bits (45), Expect = 2.6 Identities = 11/37 (29%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -1 Query: 304 GSISLSPLY-PVPTIDLQSESLRSSIRVSPDFDLTRH 197 G+ S +Y P ++ L +RV P+FD H Sbjct: 266 GAYSPKKVYAPEEVAEIVEYGLERGVRVIPEFDAPAH 302 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 106,595 Number of Sequences: 336 Number of extensions: 2242 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11420693 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -