BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0122 (490 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1327.01c ||SPAC1783.09c, SPAC18G6.16c|transcription factor, ... 27 1.1 SPBC4C3.05c |nuc1|rpa1|DNA-directed RNA polymerase I complex lar... 27 1.5 SPAC926.09c |fas1||fatty acid synthase beta subunit Fas1|Schizos... 25 6.1 SPCC297.03 |ssp1||serine/threonine protein kinase Ssp1 |Schizosa... 25 6.1 SPAPB1E7.07 |glt1||glutamate synthase Glt1 |Schizosaccharomyces ... 25 6.1 >SPAC1327.01c ||SPAC1783.09c, SPAC18G6.16c|transcription factor, zf-fungal binuclear cluster type |Schizosaccharomyces pombe|chr 1|||Manual Length = 977 Score = 27.5 bits (58), Expect = 1.1 Identities = 13/46 (28%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = -2 Query: 174 SICAQSAPSFTDW-KRDASGVRKSRT*LDNFILPERTSSVRLHFRY 40 ++C + + + DW +R +SG+++ T + I ER + HF Y Sbjct: 861 ALCDKMSEIWADWVQRTSSGIQEEDTIPNEMIDEERMLDLEKHFMY 906 >SPBC4C3.05c |nuc1|rpa1|DNA-directed RNA polymerase I complex large subunit Nuc1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1689 Score = 27.1 bits (57), Expect = 1.5 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +1 Query: 343 SWRRYKILKQSHPVKRMIRGIGAETTSTYSQ 435 S + YK L Q + VK ++ + +ET S+Y++ Sbjct: 1082 SAKNYKSLIQKYKVKSVLSAVDSETASSYAK 1112 >SPAC926.09c |fas1||fatty acid synthase beta subunit Fas1|Schizosaccharomyces pombe|chr 1|||Manual Length = 2073 Score = 25.0 bits (52), Expect = 6.1 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +3 Query: 438 FKWVRTPAYSNDEAGDL 488 F ++ P YS D+AGDL Sbjct: 443 FSALKVPVYSTDDAGDL 459 >SPCC297.03 |ssp1||serine/threonine protein kinase Ssp1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 652 Score = 25.0 bits (52), Expect = 6.1 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -3 Query: 179 VPAFVLRARLHSLIGNETPRECENH 105 VP FV LH G++TP C H Sbjct: 622 VPGFVSSPNLHLAGGSDTPIYCIEH 646 >SPAPB1E7.07 |glt1||glutamate synthase Glt1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 2111 Score = 25.0 bits (52), Expect = 6.1 Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = +3 Query: 246 DSDCKSIVGTGYRGERLI--EPSSSWFRPK 329 + DC VG G G RLI P S F+P+ Sbjct: 1381 EGDCNDYVGKGLSGGRLIIYPPRVSPFKPE 1410 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,956,416 Number of Sequences: 5004 Number of extensions: 39684 Number of successful extensions: 82 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 81 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 82 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 190087364 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -