BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0122 (490 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g08480.1 68417.m01399 mitogen-activated protein kinase, putat... 30 0.73 At4g33370.1 68417.m04744 DEAD-box protein abstrakt, putative RNA... 28 2.9 At1g74690.1 68414.m08650 calmodulin-binding family protein low s... 27 5.1 At2g38320.1 68415.m04708 expressed protein 27 6.8 At5g61270.1 68418.m07689 basic helix-loop-helix (bHLH) family pr... 27 9.0 At4g08360.1 68417.m01381 KOW domain-containing protein contains ... 27 9.0 >At4g08480.1 68417.m01399 mitogen-activated protein kinase, putative similar to mitogen-activated protein kinase [Arabidopsis thaliana] gi|1255448|dbj|BAA09057; contains Pfam PF00069: Protein kinase domain Length = 773 Score = 30.3 bits (65), Expect = 0.73 Identities = 17/69 (24%), Positives = 29/69 (42%) Frame = -1 Query: 364 KFYIDASYPEGNFGRNQLLDGSISLSPLYPVPTIDLQSESLRSSIRVSPDFDLTRHSSPS 185 K +D+ E G + + P+ +P +DL S +PD ++ R S S Sbjct: 375 KEVVDSGTVENRRGIKGVRPSVLKPPPVMKLPPVDLPGSSWDILTHFAPDSEIVRRPSSS 434 Query: 184 FGSQHLCSE 158 S++ C E Sbjct: 435 SSSENGCDE 443 >At4g33370.1 68417.m04744 DEAD-box protein abstrakt, putative RNA helicase DBP2 - Saccharomyces cerevisiae, PID:g5272 Length = 542 Score = 28.3 bits (60), Expect = 2.9 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +3 Query: 204 VRSKSGETLMEDRSDSDCKSIVGTGYRGERLIEPSSSWFRP 326 V + G+ +ME SD VG RG EP S+W++P Sbjct: 24 VVEEPGKGMMEHLSDKKKLMSVGELARGITYTEPLSTWWKP 64 >At1g74690.1 68414.m08650 calmodulin-binding family protein low similarity to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 587 Score = 27.5 bits (58), Expect = 5.1 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = -1 Query: 481 PASSFE*AGVLTHLKFENRLRSFR 410 PAS+FE + V T +FE RSFR Sbjct: 290 PASNFESSSVQTSFEFEKPKRSFR 313 >At2g38320.1 68415.m04708 expressed protein Length = 410 Score = 27.1 bits (57), Expect = 6.8 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +3 Query: 399 RHWGRNDLNLFSNFKWVRTP 458 RHW +D+ +F+++ W R P Sbjct: 215 RHWTNSDIIVFNSYLWWRMP 234 >At5g61270.1 68418.m07689 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 366 Score = 26.6 bits (56), Expect = 9.0 Identities = 12/49 (24%), Positives = 25/49 (51%) Frame = +1 Query: 325 RSFPQDSWRRYKILKQSHPVKRMIRGIGAETTSTYSQTLNG*ELRLTRT 471 R +PQ+ R + + ++SH V + + T +++ +G L+ RT Sbjct: 83 RGYPQEMDRWFAVQEESHRVGHSVTASASGTNMSWASFESGRSLKTART 131 >At4g08360.1 68417.m01381 KOW domain-containing protein contains Pfam PF00467: KOW motif Length = 141 Score = 26.6 bits (56), Expect = 9.0 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +3 Query: 228 LMEDRSDSDCKSIVGTGYRGERLIEPSS 311 ++ D SD CK +G+G G+ ++ PSS Sbjct: 55 VIRDVSDGMCKVSLGSGGEGDTIMVPSS 82 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,250,188 Number of Sequences: 28952 Number of extensions: 213864 Number of successful extensions: 462 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 456 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 462 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 848837888 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -