BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0120 (645 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q4PMZ6 Cluster: Putative secreted protein; n=1; Ixodes ... 63 5e-09 UniRef50_Q6QI94 Cluster: LRRG00114; n=1; Rattus norvegicus|Rep: ... 48 2e-04 UniRef50_UPI0000ECD483 Cluster: UPI0000ECD483 related cluster; n... 43 0.007 UniRef50_UPI0000E7FA5A Cluster: PREDICTED: hypothetical protein;... 42 0.017 UniRef50_Q7RED5 Cluster: Putative uncharacterized protein PY0513... 40 0.068 UniRef50_Q6Z8F1 Cluster: Putative uncharacterized protein P0459B... 37 0.36 UniRef50_A7HQK3 Cluster: Cytochrome c oxidase subunit II; n=1; P... 35 1.5 UniRef50_A2GSA9 Cluster: Putative uncharacterized protein; n=3; ... 34 2.6 UniRef50_Q28GS0 Cluster: Novel protein; n=1; Xenopus tropicalis|... 33 5.9 UniRef50_Q0FI72 Cluster: Putative uncharacterized protein; n=1; ... 33 5.9 UniRef50_Q64CM7 Cluster: Putative uncharacterized protein; n=1; ... 33 5.9 >UniRef50_Q4PMZ6 Cluster: Putative secreted protein; n=1; Ixodes scapularis|Rep: Putative secreted protein - Ixodes scapularis (Black-legged tick) (Deer tick) Length = 65 Score = 63.3 bits (147), Expect = 5e-09 Identities = 30/53 (56%), Positives = 35/53 (66%) Frame = +3 Query: 57 PY*GDTANGSIYQFWFLRSYSVTWITVVILELIHAIRTLTSDGMSAFIRSKPI 215 P G+TANGS+ Q WFLRS+ TWITV ILELIHA+ AFIR + I Sbjct: 2 PKQGETANGSLNQLWFLRSFLPTWITVAILELIHAVSPKPLGATGAFIRPRSI 54 >UniRef50_Q6QI94 Cluster: LRRG00114; n=1; Rattus norvegicus|Rep: LRRG00114 - Rattus norvegicus (Rat) Length = 223 Score = 48.0 bits (109), Expect = 2e-04 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = -3 Query: 436 LLPSLDVVAVSQAPSPESNPDSP 368 LLPSLDVVAVSQAPSPE NPDSP Sbjct: 167 LLPSLDVVAVSQAPSPELNPDSP 189 >UniRef50_UPI0000ECD483 Cluster: UPI0000ECD483 related cluster; n=1; Gallus gallus|Rep: UPI0000ECD483 UniRef100 entry - Gallus gallus Length = 103 Score = 42.7 bits (96), Expect = 0.007 Identities = 30/61 (49%), Positives = 33/61 (54%) Frame = -2 Query: 638 TTSFLTATILVYXXXXXXXXXXXTRLALQLFLVKIFKVYSFRLQAS*ESRIVIYRYYLPC 459 TTSFLTA L+Y TRLALQ LVK FKV SF+LQ E + Y LP Sbjct: 40 TTSFLTAATLIYAIGAGITAAAGTRLALQWILVKGFKVDSFQLQGL-ERVLYCYFSSLPP 98 Query: 458 R 456 R Sbjct: 99 R 99 >UniRef50_UPI0000E7FA5A Cluster: PREDICTED: hypothetical protein; n=2; Gallus gallus|Rep: PREDICTED: hypothetical protein - Gallus gallus Length = 508 Score = 41.5 bits (93), Expect = 0.017 Identities = 19/31 (61%), Positives = 20/31 (64%) Frame = +2 Query: 122 YLDNCGNSRANTCNQNSDQ*WDECFY*IKTN 214 YLDNCGNSRANTC + D C Y KTN Sbjct: 468 YLDNCGNSRANTCRRAPTS-GDACIYQTKTN 497 >UniRef50_Q7RED5 Cluster: Putative uncharacterized protein PY05130; n=6; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein PY05130 - Plasmodium yoelii yoelii Length = 402 Score = 39.5 bits (88), Expect = 0.068 Identities = 18/31 (58%), Positives = 23/31 (74%) Frame = -3 Query: 415 VAVSQAPSPESNPDSPLPVTTMVVAXTTIES 323 +A+SQAPSPESN +SPLPV M+ I+S Sbjct: 372 LAISQAPSPESNSNSPLPVKAMLGQYPNIKS 402 >UniRef50_Q6Z8F1 Cluster: Putative uncharacterized protein P0459B01.16; n=1; Oryza sativa (japonica cultivar-group)|Rep: Putative uncharacterized protein P0459B01.16 - Oryza sativa subsp. japonica (Rice) Length = 172 Score = 37.1 bits (82), Expect = 0.36 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 1 LPVVICLSQRLSHACLS 51 LPVVICLSQRLSHAC S Sbjct: 154 LPVVICLSQRLSHACAS 170 >UniRef50_A7HQK3 Cluster: Cytochrome c oxidase subunit II; n=1; Parvibaculum lavamentivorans DS-1|Rep: Cytochrome c oxidase subunit II - Parvibaculum lavamentivorans DS-1 Length = 394 Score = 35.1 bits (77), Expect = 1.5 Identities = 25/67 (37%), Positives = 32/67 (47%) Frame = -2 Query: 557 LQLFLVKIFKVYSFRLQAS*ESRIVIYRYYLPCREWVICAPAAFLGCGSRFSGSLSGIEP 378 L L L ++F+V F S +I + R R ICA AA GC SG LS ++P Sbjct: 140 LDLRLDRVFRVVGFAHDTSPIRKITLLRRGPFRRAAAICAGAALSGC----SGDLSALDP 195 Query: 377 *FPVTRD 357 P RD Sbjct: 196 AGPAARD 202 >UniRef50_A2GSA9 Cluster: Putative uncharacterized protein; n=3; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 76 Score = 34.3 bits (75), Expect = 2.6 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -1 Query: 594 SWNYRGCWHQTCP 556 SWNYR CWHQT P Sbjct: 7 SWNYRSCWHQTGP 19 >UniRef50_Q28GS0 Cluster: Novel protein; n=1; Xenopus tropicalis|Rep: Novel protein - Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Length = 118 Score = 33.1 bits (72), Expect = 5.9 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = +2 Query: 308 MSALSTFDGSXCDYHG 355 MSALSTFDG+ C YHG Sbjct: 1 MSALSTFDGTFCAYHG 16 >UniRef50_Q0FI72 Cluster: Putative uncharacterized protein; n=1; Roseovarius sp. HTCC2601|Rep: Putative uncharacterized protein - Roseovarius sp. HTCC2601 Length = 507 Score = 33.1 bits (72), Expect = 5.9 Identities = 16/40 (40%), Positives = 24/40 (60%) Frame = +3 Query: 114 YSVTWITVVILELIHAIRTLTSDGMSAFIRSKPIDGGPRV 233 YS T + VV+ EL+ T+ SD +A I + P+DG R+ Sbjct: 139 YSATSMAVVLSELVVDDETIPSDNAAAQISAGPVDGETRI 178 >UniRef50_Q64CM7 Cluster: Putative uncharacterized protein; n=1; uncultured archaeon GZfos1D1|Rep: Putative uncharacterized protein - uncultured archaeon GZfos1D1 Length = 448 Score = 33.1 bits (72), Expect = 5.9 Identities = 17/32 (53%), Positives = 20/32 (62%) Frame = +3 Query: 390 GEGA*ETATTSKEGSRRANYPLPAREVVTINN 485 G+G ETA E +R NYPLP R VV +NN Sbjct: 407 GKGL-ETAVQRLEENRIPNYPLPERAVVALNN 437 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 620,792,860 Number of Sequences: 1657284 Number of extensions: 12370692 Number of successful extensions: 29827 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 28651 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29816 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 48541014171 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -