BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0120 (645 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59794| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_56793| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_1371| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.049 SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.049 SB_18079| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_25694| Best HMM Match : RVT_1 (HMM E-Value=1.9e-22) 32 0.46 SB_15796| Best HMM Match : RVT_1 (HMM E-Value=0.00082) 32 0.46 SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) 28 7.5 SB_17017| Best HMM Match : TIL (HMM E-Value=4.8) 27 9.9 SB_35070| Best HMM Match : TIL (HMM E-Value=8.6) 27 9.9 SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 >SB_59794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = -3 Query: 421 DVVAVSQAPSPESNPDSPLPVTTM 350 DVVAVSQAPSPESNP+SP PV TM Sbjct: 105 DVVAVSQAPSPESNPNSPSPVVTM 128 >SB_56793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 42.3 bits (95), Expect = 3e-04 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = +1 Query: 1 LPVVICLSQRLSHACLSASRIKAIPRMA 84 LPVVICLSQRLSHACLS S RMA Sbjct: 134 LPVVICLSQRLSHACLSISTCTVKLRMA 161 >SB_1371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 41.5 bits (93), Expect = 6e-04 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = +1 Query: 1 LPVVICLSQRLSHACLSASRIKAIPRMA 84 LPVVICLSQRLSHACLS S RMA Sbjct: 110 LPVVICLSQRLSHACLSISTRTVKLRMA 137 >SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 41.1 bits (92), Expect = 7e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 412 AVSQAPSPESNPDSPLPVTTM 350 AVSQAPSPESNP+SP PV TM Sbjct: 52 AVSQAPSPESNPNSPSPVVTM 72 >SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 35.1 bits (77), Expect = 0.049 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -1 Query: 411 PFLRLPLRNRTLIPRYP 361 PFLRLPLRNRTLI R+P Sbjct: 224 PFLRLPLRNRTLILRHP 240 >SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 35.1 bits (77), Expect = 0.049 Identities = 18/48 (37%), Positives = 25/48 (52%) Frame = +1 Query: 502 EACNRNEYTLNILTRNNWRASLXXXXXXXXXXXXYTKIVAVKKLVVPF 645 + R ++++ R +WRASL Y K+VAVKKLVV F Sbjct: 47 QTTTRVHAAMHLVIRIHWRASLVPAAAVIPAPIAYIKVVAVKKLVVGF 94 >SB_18079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 32.7 bits (71), Expect = 0.26 Identities = 17/34 (50%), Positives = 19/34 (55%) Frame = +1 Query: 544 RNNWRASLXXXXXXXXXXXXYTKIVAVKKLVVPF 645 R +WRASL Y K+VAVKKLVV F Sbjct: 14 RIHWRASLVPAAAVIPAPIAYIKVVAVKKLVVGF 47 >SB_25694| Best HMM Match : RVT_1 (HMM E-Value=1.9e-22) Length = 1797 Score = 31.9 bits (69), Expect = 0.46 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = +2 Query: 11 LYACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYLDNCGNS 145 L CL D A+ ++ + +Y W+N+ +LV L ++ CG+S Sbjct: 447 LMTCLYDKAVFLTDEEYAAKYGRWVNVQMLVEEPELHFIAKCGSS 491 >SB_15796| Best HMM Match : RVT_1 (HMM E-Value=0.00082) Length = 1304 Score = 31.9 bits (69), Expect = 0.46 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = +2 Query: 11 LYACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYLDNCGNS 145 L CL D A+ ++ + +Y W+N+ +LV L ++ CG+S Sbjct: 866 LMTCLYDKAVFLTDEEYAAKYGRWVNVQMLVEEPELHFIAKCGSS 910 >SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) Length = 441 Score = 27.9 bits (59), Expect = 7.5 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -3 Query: 430 PSLDVVAVSQAPSPESNPDSPLP 362 P+ DV+A Q P P S D PLP Sbjct: 75 PAEDVMAAHQEPKPTSAIDQPLP 97 >SB_17017| Best HMM Match : TIL (HMM E-Value=4.8) Length = 171 Score = 27.5 bits (58), Expect = 9.9 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +1 Query: 1 LPVVICLSQRLS 36 LPVVICLSQRLS Sbjct: 155 LPVVICLSQRLS 166 >SB_35070| Best HMM Match : TIL (HMM E-Value=8.6) Length = 147 Score = 27.5 bits (58), Expect = 9.9 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +1 Query: 1 LPVVICLSQRLS 36 LPVVICLSQRLS Sbjct: 131 LPVVICLSQRLS 142 >SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 603 Score = 27.5 bits (58), Expect = 9.9 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = -3 Query: 430 PSLDVVAVSQAPSPESNPDSPLPVTTMVVAXTTI 329 P ++ P P++ P P P TTM TTI Sbjct: 438 PPPSIIPPPTTPLPQTVPTPPRPPTTMTTILTTI 471 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,275,046 Number of Sequences: 59808 Number of extensions: 397815 Number of successful extensions: 994 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 946 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 994 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1633044375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -