BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0118 (428 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46117| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 3e-14 SB_56296| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 2e-13 SB_30350| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 4e-13 SB_21596| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 7e-13 SB_54484| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 5e-12 SB_47613| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_22783| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 3e-11 SB_45982| Best HMM Match : TIL (HMM E-Value=2.5) 64 4e-11 SB_16598| Best HMM Match : TIL (HMM E-Value=2.5) 64 4e-11 SB_12257| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 5e-11 SB_45011| Best HMM Match : FYVE (HMM E-Value=9.8) 64 5e-11 SB_55150| Best HMM Match : TIL (HMM E-Value=2.5) 64 6e-11 SB_49087| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 8e-11 SB_23403| Best HMM Match : FYVE (HMM E-Value=9.8) 63 8e-11 SB_56250| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 1e-10 SB_49567| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 1e-10 SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 1e-10 SB_9699| Best HMM Match : FYVE (HMM E-Value=9.8) 62 1e-10 SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 2e-10 SB_48355| Best HMM Match : Herpes_US9 (HMM E-Value=4.7) 61 4e-10 SB_17609| Best HMM Match : Herpes_US9 (HMM E-Value=4.7) 61 4e-10 SB_50595| Best HMM Match : Herpes_US9 (HMM E-Value=2.5) 60 8e-10 SB_11205| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 8e-10 SB_28753| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 1e-09 SB_45893| Best HMM Match : Arc (HMM E-Value=3.3) 58 2e-09 SB_51709| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 2e-09 SB_1551| Best HMM Match : WD40 (HMM E-Value=0.0019) 58 2e-09 SB_26770| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_35044| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_19267| Best HMM Match : TIL (HMM E-Value=2.5) 57 7e-09 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 54 4e-08 SB_44725| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_9377| Best HMM Match : DUF1550 (HMM E-Value=4) 46 1e-05 SB_1081| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 5e-05 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 40 7e-04 SB_58476| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_58117| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_57051| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_56735| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_47630| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_42617| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_40153| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_36940| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_35936| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_22548| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_21972| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_21946| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_19156| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_18757| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_18471| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_8094| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_4926| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_57173| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_55458| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_52064| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_41855| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_41222| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_40101| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_30251| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_29656| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_25406| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_24218| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_20995| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_20749| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_20494| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_18082| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_16777| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 33 0.13 SB_16129| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_14158| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_10058| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_6526| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_1429| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_1346| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_14822| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.94 SB_42677| Best HMM Match : TUDOR (HMM E-Value=0) 29 1.6 SB_46123| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_41816| Best HMM Match : Peptidase_M10 (HMM E-Value=0) 29 2.2 SB_51133| Best HMM Match : Pox_A32 (HMM E-Value=0.028) 28 3.8 SB_59619| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_58926| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_29891| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 >SB_46117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 74.5 bits (175), Expect = 3e-14 Identities = 40/58 (68%), Positives = 43/58 (74%) Frame = +2 Query: 254 RTRATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFV 427 RTRATL S P P G GN +K RAGD LQL +NEEFLVSASH+LALITSLPFV Sbjct: 8 RTRATLTVSRVFPSPEGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFV 65 >SB_56296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 71.7 bits (168), Expect = 2e-13 Identities = 43/82 (52%), Positives = 51/82 (62%) Frame = +2 Query: 182 RGTGVFEPHEIEQ*QVCDALRCPGRTRATLKESACSPWPRGPGNPLKLLRAGDWGLQLSP 361 RGTG++E + Q C L C +LK S +G GN +K RAGD LQL Sbjct: 29 RGTGIWEQVVSGRAQRCSNLTCISLALLSLKWMRSSQ-VKGVGNLVKYRRAGDRSLQLLI 87 Query: 362 INEEFLVSASHKLALITSLPFV 427 +NEEFLVSASH+LALITSLPFV Sbjct: 88 LNEEFLVSASHQLALITSLPFV 109 >SB_30350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 70.9 bits (166), Expect = 4e-13 Identities = 38/59 (64%), Positives = 41/59 (69%) Frame = +2 Query: 251 GRTRATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFV 427 GRTRATL P P G GN +K RAGD +L NEEFLVSASH+LALITSLPFV Sbjct: 4 GRTRATLTGQRVFPSPEGGGNLVKHRRAGDRSCKLLIFNEEFLVSASHQLALITSLPFV 62 >SB_21596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 70.1 bits (164), Expect = 7e-13 Identities = 40/60 (66%), Positives = 44/60 (73%), Gaps = 1/60 (1%) Frame = +2 Query: 251 GRTRATLKESACSPWPR-GPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFV 427 GRTRATL S + R G GN +K RAGD LQL +NEEFLVSASH+LALITSLPFV Sbjct: 7 GRTRATLTVSTSLSFARKGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFV 66 >SB_54484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 67.3 bits (157), Expect = 5e-12 Identities = 37/59 (62%), Positives = 41/59 (69%) Frame = +2 Query: 251 GRTRATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFV 427 GRTRATL S + G GN +K RAGD +L NEEFLVSASH+LALITSLPFV Sbjct: 7 GRTRATLTVSTSLSFAGGVGNLVKHRRAGDRSCKLLIFNEEFLVSASHQLALITSLPFV 65 >SB_47613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 65.7 bits (153), Expect = 2e-11 Identities = 38/60 (63%), Positives = 42/60 (70%), Gaps = 1/60 (1%) Frame = +2 Query: 251 GRTRATLKESACSPWPR-GPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFV 427 GR R TL S + R G GN +K RAGD LQL +NEEFLVSASH+LALITSLPFV Sbjct: 7 GRPRVTLTVSTSLSFRRKGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFV 66 >SB_22783| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 64.9 bits (151), Expect = 3e-11 Identities = 38/60 (63%), Positives = 41/60 (68%), Gaps = 1/60 (1%) Frame = +2 Query: 251 GRTRA-TLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFV 427 GRTR T + P P G GN +K RAGD LQL NEEFLVSASH+LALITSLPFV Sbjct: 7 GRTRRYTDGVNESFPRPEGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFV 66 >SB_45982| Best HMM Match : TIL (HMM E-Value=2.5) Length = 211 Score = 64.5 bits (150), Expect = 4e-11 Identities = 33/56 (58%), Positives = 41/56 (73%) Frame = +2 Query: 260 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFV 427 R ++++ C+ G GN +K RAGD LQL +NEEFLVSASH+LALITSLPFV Sbjct: 121 RKVIRKATCARCFAGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFV 176 >SB_16598| Best HMM Match : TIL (HMM E-Value=2.5) Length = 216 Score = 64.5 bits (150), Expect = 4e-11 Identities = 33/56 (58%), Positives = 41/56 (73%) Frame = +2 Query: 260 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFV 427 R ++++ C+ G GN +K RAGD LQL +NEEFLVSASH+LALITSLPFV Sbjct: 126 RKVIRKATCARCFAGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFV 181 >SB_12257| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 64.1 bits (149), Expect = 5e-11 Identities = 33/56 (58%), Positives = 40/56 (71%) Frame = +2 Query: 260 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFV 427 R +++ C+ G GN +K RAGD LQL +NEEFLVSASH+LALITSLPFV Sbjct: 165 RKVTRKATCARCFAGVGNLVKYRRAGDRSLQLLILNEEFLVSASHQLALITSLPFV 220 >SB_45011| Best HMM Match : FYVE (HMM E-Value=9.8) Length = 163 Score = 64.1 bits (149), Expect = 5e-11 Identities = 33/56 (58%), Positives = 40/56 (71%) Frame = +2 Query: 260 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFV 427 R +++ C+ G GN +K RAGD LQL +NEEFLVSASH+LALITSLPFV Sbjct: 73 RKVTRKATCARCFAGVGNLVKYRRAGDRSLQLLILNEEFLVSASHQLALITSLPFV 128 >SB_55150| Best HMM Match : TIL (HMM E-Value=2.5) Length = 211 Score = 63.7 bits (148), Expect = 6e-11 Identities = 33/56 (58%), Positives = 40/56 (71%) Frame = +2 Query: 260 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFV 427 R ++++ C+ G GN +K RAGD LQL NEEFLVSASH+LALITSLPFV Sbjct: 121 RKVIRKATCARCFAGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFV 176 >SB_49087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 63.3 bits (147), Expect = 8e-11 Identities = 33/56 (58%), Positives = 40/56 (71%) Frame = +2 Query: 260 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFV 427 R +++ C+ G GN +K RAGD LQL +NEEFLVSASH+LALITSLPFV Sbjct: 73 RKVTRKATCARCFAGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFV 128 >SB_23403| Best HMM Match : FYVE (HMM E-Value=9.8) Length = 137 Score = 63.3 bits (147), Expect = 8e-11 Identities = 33/56 (58%), Positives = 40/56 (71%) Frame = +2 Query: 260 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFV 427 R +++ C+ G GN +K RAGD LQL +NEEFLVSASH+LALITSLPFV Sbjct: 47 RKVTRKATCARCFAGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFV 102 >SB_56250| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 62.5 bits (145), Expect = 1e-10 Identities = 33/56 (58%), Positives = 39/56 (69%) Frame = +2 Query: 260 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFV 427 R +++ C+ G GN +K RAGD LQL NEEFLVSASH+LALITSLPFV Sbjct: 126 RKVTRKATCARCFAGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFV 181 >SB_49567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 62.5 bits (145), Expect = 1e-10 Identities = 33/56 (58%), Positives = 39/56 (69%) Frame = +2 Query: 260 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFV 427 R +++ C+ G GN +K RAGD LQL NEEFLVSASH+LALITSLPFV Sbjct: 73 RKVTRKATCARCFAGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFV 128 >SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 62.5 bits (145), Expect = 1e-10 Identities = 32/44 (72%), Positives = 35/44 (79%) Frame = +2 Query: 296 PRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFV 427 P+G GN +K RAGD LQL NEEFLVSASH+LALITSLPFV Sbjct: 102 PQGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFV 145 >SB_9699| Best HMM Match : FYVE (HMM E-Value=9.8) Length = 163 Score = 62.5 bits (145), Expect = 1e-10 Identities = 33/56 (58%), Positives = 39/56 (69%) Frame = +2 Query: 260 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFV 427 R +++ C+ G GN +K RAGD LQL NEEFLVSASH+LALITSLPFV Sbjct: 73 RKVTRKATCARCFAGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFV 128 >SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 62.1 bits (144), Expect = 2e-10 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = +2 Query: 296 PRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFV 427 P+G GN +K RAGD LQL +NEEFLVSA+H+LALITSLPFV Sbjct: 42 PQGVGNLVKHRRAGDRSLQLLILNEEFLVSANHQLALITSLPFV 85 >SB_48355| Best HMM Match : Herpes_US9 (HMM E-Value=4.7) Length = 98 Score = 60.9 bits (141), Expect = 4e-10 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +2 Query: 299 RGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFV 427 +G GN +K RAGD LQL +NEEFLVSASH+LALITSLPFV Sbjct: 21 KGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFV 63 >SB_17609| Best HMM Match : Herpes_US9 (HMM E-Value=4.7) Length = 98 Score = 60.9 bits (141), Expect = 4e-10 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +2 Query: 299 RGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFV 427 +G GN +K RAGD LQL +NEEFLVSASH+LALITSLPFV Sbjct: 21 KGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFV 63 >SB_50595| Best HMM Match : Herpes_US9 (HMM E-Value=2.5) Length = 101 Score = 60.1 bits (139), Expect = 8e-10 Identities = 31/43 (72%), Positives = 34/43 (79%) Frame = +2 Query: 299 RGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFV 427 +G GN +K RAGD LQL NEEFLVSASH+LALITSLPFV Sbjct: 24 KGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFV 66 >SB_11205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 60.1 bits (139), Expect = 8e-10 Identities = 32/56 (57%), Positives = 39/56 (69%) Frame = +2 Query: 260 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFV 427 R +++ C+ G GN +K RA D LQL +NEEFLVSASH+LALITSLPFV Sbjct: 73 RKVTRKATCARCFAGVGNLVKHRRARDRSLQLLILNEEFLVSASHQLALITSLPFV 128 >SB_28753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 59.3 bits (137), Expect = 1e-09 Identities = 31/42 (73%), Positives = 33/42 (78%) Frame = +2 Query: 302 GPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFV 427 G GN +K RAGD LQL NEEFLVSASH+LALITSLPFV Sbjct: 22 GVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFV 63 >SB_45893| Best HMM Match : Arc (HMM E-Value=3.3) Length = 186 Score = 58.4 bits (135), Expect = 2e-09 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = +2 Query: 308 GNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFV 427 GN +K RAGD LQL +NEEFLVSASH+LALITSLPFV Sbjct: 3 GNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFV 42 >SB_51709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 58.4 bits (135), Expect = 2e-09 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = +2 Query: 308 GNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFV 427 GN +K RAGD LQL +NEEFLVSASH+LALITSLPFV Sbjct: 3 GNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFV 42 >SB_1551| Best HMM Match : WD40 (HMM E-Value=0.0019) Length = 101 Score = 58.4 bits (135), Expect = 2e-09 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = +2 Query: 308 GNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFV 427 GN +K RAGD LQL +NEEFLVSASH+LALITSLPFV Sbjct: 3 GNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFV 42 >SB_26770| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 57.6 bits (133), Expect = 4e-09 Identities = 30/40 (75%), Positives = 32/40 (80%) Frame = +2 Query: 308 GNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFV 427 GN +K RAGD LQL NEEFLVSASH+LALITSLPFV Sbjct: 3 GNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFV 42 >SB_35044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 57.6 bits (133), Expect = 4e-09 Identities = 30/40 (75%), Positives = 32/40 (80%) Frame = +2 Query: 308 GNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFV 427 GN +K RAGD LQL NEEFLVSASH+LALITSLPFV Sbjct: 3 GNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFV 42 >SB_19267| Best HMM Match : TIL (HMM E-Value=2.5) Length = 214 Score = 56.8 bits (131), Expect = 7e-09 Identities = 30/42 (71%), Positives = 33/42 (78%) Frame = +2 Query: 302 GPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFV 427 G GN +K RA D LQL +NEEFLVSASH+LALITSLPFV Sbjct: 138 GVGNLVKHRRARDRSLQLLILNEEFLVSASHQLALITSLPFV 179 >SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) Length = 152 Score = 54.4 bits (125), Expect = 4e-08 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +2 Query: 329 RAGDWGLQLSPINEEFLVSASHKLALITSLPFV 427 RAGD LQL +NEEFLVSASH+LALITSLPFV Sbjct: 85 RAGDRSLQLLILNEEFLVSASHQLALITSLPFV 117 >SB_44725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 46.4 bits (105), Expect = 1e-05 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +2 Query: 347 LQLSPINEEFLVSASHKLALITSLPFV 427 LQL NEEFLVSASH+LALITSLPFV Sbjct: 30 LQLLIFNEEFLVSASHQLALITSLPFV 56 >SB_9377| Best HMM Match : DUF1550 (HMM E-Value=4) Length = 91 Score = 46.4 bits (105), Expect = 1e-05 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +2 Query: 347 LQLSPINEEFLVSASHKLALITSLPFV 427 LQL NEEFLVSASH+LALITSLPFV Sbjct: 30 LQLLIFNEEFLVSASHQLALITSLPFV 56 >SB_1081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 44.0 bits (99), Expect = 5e-05 Identities = 20/22 (90%), Positives = 22/22 (100%) Frame = +2 Query: 362 INEEFLVSASHKLALITSLPFV 427 +NEEFLVSASH+LALITSLPFV Sbjct: 7 LNEEFLVSASHQLALITSLPFV 28 >SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) Length = 157 Score = 40.3 bits (90), Expect = 7e-04 Identities = 22/40 (55%), Positives = 26/40 (65%) Frame = -1 Query: 398 AYDSRLLGIPRLWGIIANPNPQHEGVSAGCPGL*ARENML 279 A DSRLLGIPR IIA PQH+ VS P L A+E ++ Sbjct: 85 ADDSRLLGIPRSRSIIAMIYPQHDDVSQDYPRLPAKERLV 124 >SB_58476| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 32.7 bits (71), Expect = 0.13 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +2 Query: 380 VSASHKLALITSLPFV 427 VSASH+LALITSLPFV Sbjct: 14 VSASHQLALITSLPFV 29 >SB_58117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 32.7 bits (71), Expect = 0.13 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +2 Query: 380 VSASHKLALITSLPFV 427 VSASH+LALITSLPFV Sbjct: 14 VSASHQLALITSLPFV 29 >SB_57051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 32.7 bits (71), Expect = 0.13 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +2 Query: 380 VSASHKLALITSLPFV 427 VSASH+LALITSLPFV Sbjct: 14 VSASHQLALITSLPFV 29 >SB_56735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 32.7 bits (71), Expect = 0.13 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +2 Query: 380 VSASHKLALITSLPFV 427 VSASH+LALITSLPFV Sbjct: 14 VSASHQLALITSLPFV 29 >SB_47630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 32.7 bits (71), Expect = 0.13 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +2 Query: 380 VSASHKLALITSLPFV 427 VSASH+LALITSLPFV Sbjct: 14 VSASHQLALITSLPFV 29 >SB_42617| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 32.7 bits (71), Expect = 0.13 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +2 Query: 380 VSASHKLALITSLPFV 427 VSASH+LALITSLPFV Sbjct: 14 VSASHQLALITSLPFV 29 >SB_40153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 32.7 bits (71), Expect = 0.13 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +2 Query: 380 VSASHKLALITSLPFV 427 VSASH+LALITSLPFV Sbjct: 14 VSASHQLALITSLPFV 29 >SB_36940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 32.7 bits (71), Expect = 0.13 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +2 Query: 380 VSASHKLALITSLPFV 427 VSASH+LALITSLPFV Sbjct: 40 VSASHQLALITSLPFV 55 >SB_35936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 32.7 bits (71), Expect = 0.13 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +2 Query: 380 VSASHKLALITSLPFV 427 VSASH+LALITSLPFV Sbjct: 14 VSASHQLALITSLPFV 29 >SB_22548| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 32.7 bits (71), Expect = 0.13 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +2 Query: 380 VSASHKLALITSLPFV 427 VSASH+LALITSLPFV Sbjct: 14 VSASHQLALITSLPFV 29 >SB_21972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 32.7 bits (71), Expect = 0.13 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +2 Query: 380 VSASHKLALITSLPFV 427 VSASH+LALITSLPFV Sbjct: 14 VSASHQLALITSLPFV 29 >SB_21946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 32.7 bits (71), Expect = 0.13 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +2 Query: 380 VSASHKLALITSLPFV 427 VSASH+LALITSLPFV Sbjct: 14 VSASHQLALITSLPFV 29 >SB_19156| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 32.7 bits (71), Expect = 0.13 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +2 Query: 380 VSASHKLALITSLPFV 427 VSASH+LALITSLPFV Sbjct: 14 VSASHQLALITSLPFV 29 >SB_18757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 32.7 bits (71), Expect = 0.13 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +2 Query: 380 VSASHKLALITSLPFV 427 VSASH+LALITSLPFV Sbjct: 14 VSASHQLALITSLPFV 29 >SB_18471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 32.7 bits (71), Expect = 0.13 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +2 Query: 380 VSASHKLALITSLPFV 427 VSASH+LALITSLPFV Sbjct: 14 VSASHQLALITSLPFV 29 >SB_8094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 32.7 bits (71), Expect = 0.13 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +2 Query: 380 VSASHKLALITSLPFV 427 VSASH+LALITSLPFV Sbjct: 14 VSASHQLALITSLPFV 29 >SB_4926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 32.7 bits (71), Expect = 0.13 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +2 Query: 380 VSASHKLALITSLPFV 427 VSASH+LALITSLPFV Sbjct: 14 VSASHQLALITSLPFV 29 >SB_57173| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 32.7 bits (71), Expect = 0.13 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +2 Query: 380 VSASHKLALITSLPFV 427 VSASH+LALITSLPFV Sbjct: 14 VSASHQLALITSLPFV 29 >SB_55458| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 32.7 bits (71), Expect = 0.13 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +2 Query: 380 VSASHKLALITSLPFV 427 VSASH+LALITSLPFV Sbjct: 14 VSASHQLALITSLPFV 29 >SB_52064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 32.7 bits (71), Expect = 0.13 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +2 Query: 380 VSASHKLALITSLPFV 427 VSASH+LALITSLPFV Sbjct: 14 VSASHQLALITSLPFV 29 >SB_41855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 32.7 bits (71), Expect = 0.13 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +2 Query: 380 VSASHKLALITSLPFV 427 VSASH+LALITSLPFV Sbjct: 14 VSASHQLALITSLPFV 29 >SB_41222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 32.7 bits (71), Expect = 0.13 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +2 Query: 380 VSASHKLALITSLPFV 427 VSASH+LALITSLPFV Sbjct: 14 VSASHQLALITSLPFV 29 >SB_40101| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 32.7 bits (71), Expect = 0.13 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +2 Query: 380 VSASHKLALITSLPFV 427 VSASH+LALITSLPFV Sbjct: 14 VSASHQLALITSLPFV 29 >SB_30251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 32.7 bits (71), Expect = 0.13 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +2 Query: 380 VSASHKLALITSLPFV 427 VSASH+LALITSLPFV Sbjct: 14 VSASHQLALITSLPFV 29 >SB_29656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 32.7 bits (71), Expect = 0.13 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +2 Query: 380 VSASHKLALITSLPFV 427 VSASH+LALITSLPFV Sbjct: 14 VSASHQLALITSLPFV 29 >SB_25406| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 32.7 bits (71), Expect = 0.13 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +2 Query: 380 VSASHKLALITSLPFV 427 VSASH+LALITSLPFV Sbjct: 14 VSASHQLALITSLPFV 29 >SB_24218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 32.7 bits (71), Expect = 0.13 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +2 Query: 380 VSASHKLALITSLPFV 427 VSASH+LALITSLPFV Sbjct: 14 VSASHQLALITSLPFV 29 >SB_20995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 32.7 bits (71), Expect = 0.13 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +2 Query: 380 VSASHKLALITSLPFV 427 VSASH+LALITSLPFV Sbjct: 14 VSASHQLALITSLPFV 29 >SB_20749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 32.7 bits (71), Expect = 0.13 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +2 Query: 380 VSASHKLALITSLPFV 427 VSASH+LALITSLPFV Sbjct: 14 VSASHQLALITSLPFV 29 >SB_20494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 32.7 bits (71), Expect = 0.13 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +2 Query: 380 VSASHKLALITSLPFV 427 VSASH+LALITSLPFV Sbjct: 14 VSASHQLALITSLPFV 29 >SB_18082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 32.7 bits (71), Expect = 0.13 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +2 Query: 380 VSASHKLALITSLPFV 427 VSASH+LALITSLPFV Sbjct: 14 VSASHQLALITSLPFV 29 >SB_16777| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) Length = 167 Score = 32.7 bits (71), Expect = 0.13 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +2 Query: 380 VSASHKLALITSLPFV 427 VSASH+LALITSLPFV Sbjct: 15 VSASHQLALITSLPFV 30 >SB_16129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 32.7 bits (71), Expect = 0.13 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +2 Query: 380 VSASHKLALITSLPFV 427 VSASH+LALITSLPFV Sbjct: 14 VSASHQLALITSLPFV 29 >SB_14158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 32.7 bits (71), Expect = 0.13 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +2 Query: 380 VSASHKLALITSLPFV 427 VSASH+LALITSLPFV Sbjct: 14 VSASHQLALITSLPFV 29 >SB_10058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 32.7 bits (71), Expect = 0.13 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +2 Query: 380 VSASHKLALITSLPFV 427 VSASH+LALITSLPFV Sbjct: 14 VSASHQLALITSLPFV 29 >SB_6526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 32.7 bits (71), Expect = 0.13 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +2 Query: 380 VSASHKLALITSLPFV 427 VSASH+LALITSLPFV Sbjct: 14 VSASHQLALITSLPFV 29 >SB_1429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 32.7 bits (71), Expect = 0.13 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +2 Query: 380 VSASHKLALITSLPFV 427 VSASH+LALITSLPFV Sbjct: 92 VSASHQLALITSLPFV 107 >SB_1346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 32.7 bits (71), Expect = 0.13 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +2 Query: 380 VSASHKLALITSLPFV 427 VSASH+LALITSLPFV Sbjct: 14 VSASHQLALITSLPFV 29 >SB_14822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 29.9 bits (64), Expect = 0.94 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -1 Query: 428 VQRAGT*STRAYDSRLLGIPR 366 VQRAGT S D RLLGIPR Sbjct: 47 VQRAGTQSMHIDDMRLLGIPR 67 >SB_42677| Best HMM Match : TUDOR (HMM E-Value=0) Length = 1150 Score = 29.1 bits (62), Expect = 1.6 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 3/42 (7%) Frame = +2 Query: 260 RATLKESACSPWPRGPGNPLKLLRA---GDWGLQLSPINEEF 376 +AT+++ P+P G LK++ W L L PIN EF Sbjct: 325 KATVQKVYLKPYPLADGTSLKVIVTEVISPWELWLQPINTEF 366 >SB_46123| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 771 Score = 28.7 bits (61), Expect = 2.2 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 3/40 (7%) Frame = -1 Query: 428 VQRAGT*STRAYDSRLLGIPRLW---GIIANPNPQHEGVS 318 VQ G TR+Y S L +W G+ NP+PQ +G S Sbjct: 535 VQTVGKAPTRSYHSCTLYRGEMWVIGGVYPNPDPQPDGCS 574 >SB_41816| Best HMM Match : Peptidase_M10 (HMM E-Value=0) Length = 556 Score = 28.7 bits (61), Expect = 2.2 Identities = 17/46 (36%), Positives = 22/46 (47%) Frame = -3 Query: 366 FMGDNCKPQSPARRSFSGLPGPLGQGEHADSFSVARVRPGHLRASQ 229 + G P P R S GLPG + + +DSFS+A R SQ Sbjct: 367 YQGFKVYPDYPKRISNWGLPGKVDELAPSDSFSLAASNRCRYRQSQ 412 >SB_51133| Best HMM Match : Pox_A32 (HMM E-Value=0.028) Length = 1736 Score = 27.9 bits (59), Expect = 3.8 Identities = 11/35 (31%), Positives = 21/35 (60%), Gaps = 2/35 (5%) Frame = -3 Query: 264 ARVRPGHLRASQTCYCSISCGSKTP--VPLRRILI 166 ARV + ++TC+C+ CGS+ P +P +++ Sbjct: 1083 ARVHTKLSKDTKTCFCAKRCGSEDPKNIPFNALIV 1117 >SB_59619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 448 Score = 27.9 bits (59), Expect = 3.8 Identities = 17/58 (29%), Positives = 29/58 (50%) Frame = -3 Query: 348 KPQSPARRSFSGLPGPLGQGEHADSFSVARVRPGHLRASQTCYCSISCGSKTPVPLRR 175 KP++P + SG+ G +G HA F++ + P ++ S TC + K PL + Sbjct: 12 KPKNPYSVA-SGILGQVGISHHAPEFTIPLMVPLLIQDSFTCEEEPAVEEKVASPLNK 68 >SB_58926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2371 Score = 27.1 bits (57), Expect = 6.6 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +2 Query: 53 LVERFVWLIPVTNETLAC 106 LV RFV ++PVT+ T AC Sbjct: 1290 LVARFVRMLPVTHHTAAC 1307 >SB_29891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 468 Score = 27.1 bits (57), Expect = 6.6 Identities = 13/28 (46%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +2 Query: 230 CDALRCPGRTRATLKESACS-PWPRGPG 310 CD L C GR + E C PW GPG Sbjct: 335 CDPLDCNGRGTCQMGECVCDHPW-TGPG 361 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,613,387 Number of Sequences: 59808 Number of extensions: 268580 Number of successful extensions: 843 Number of sequences better than 10.0: 81 Number of HSP's better than 10.0 without gapping: 687 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 842 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 826502419 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -