BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0116 (687 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_13467| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) 45 7e-05 SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 43 3e-04 SB_7775| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_29359| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_19053| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_11440| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_6844| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_59236| Best HMM Match : Attractin (HMM E-Value=8.2) 37 0.013 SB_15603| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_20448| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_19187| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_161| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.094 SB_32500| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_24543| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_5288| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_4968| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_3995| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_1350| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_53668| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_53194| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_47973| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_40285| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_16426| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) 32 0.38 SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.38 SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.38 SB_1848| Best HMM Match : Galactosyl_T (HMM E-Value=1.4e-26) 29 3.5 SB_54195| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_40592| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_36629| Best HMM Match : Fer2 (HMM E-Value=0.0041) 29 4.7 SB_58055| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_55300| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_54389| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_53216| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_51835| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_49224| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_48809| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_41857| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_40886| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_40435| Best HMM Match : DUF1677 (HMM E-Value=4.2) 28 6.2 SB_27787| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_27353| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_24856| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_16637| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_9214| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_5959| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_3984| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_47626| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_23657| Best HMM Match : Sushi (HMM E-Value=0) 28 8.1 >SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 62.5 bits (145), Expect = 3e-10 Identities = 31/47 (65%), Positives = 34/47 (72%), Gaps = 1/47 (2%) Frame = +1 Query: 550 KAPKKRSWDTMKGVGRS*QQDGGHGSRNPLRXC-TTHLPKQPALKMD 687 + +RS D KGVG S QQDGGHGS NP + C TTHLPKQ ALKMD Sbjct: 10 RCQSRRSSDPTKGVGCSRQQDGGHGSWNPAKECVTTHLPKQLALKMD 56 >SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 60.5 bits (140), Expect = 1e-09 Identities = 31/47 (65%), Positives = 34/47 (72%), Gaps = 1/47 (2%) Frame = +1 Query: 550 KAPKKRSWDTMKGVGRS*QQDGGHGSRNPLRXC-TTHLPKQPALKMD 687 + +RS D KGVG S QQDGGHGS NPL+ C TT LPKQ ALKMD Sbjct: 10 RCQSRRSSDPTKGVGCSRQQDGGHGSWNPLKECVTTPLPKQLALKMD 56 >SB_13467| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 38 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -1 Query: 243 NRYGPPSGFPLTST*PGIVHHLSGPSICA 157 NRY PP FPL S GIVHHLSGP+ CA Sbjct: 1 NRYEPPPEFPLASPYSGIVHHLSGPNRCA 29 >SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) Length = 276 Score = 44.8 bits (101), Expect = 7e-05 Identities = 29/64 (45%), Positives = 35/64 (54%) Frame = -3 Query: 610 PAVMSDQRLSWCPMSVF*AP*TTFGSSHSASSAYKIGPLGTVIRSPASSFE*AGVLTHLK 431 P V SD+R W P F GSS ASS Y+ GP T I P + + G+LT+LK Sbjct: 62 PFVGSDERRLWHPYRAF-------GSSRIASSGYQNGPTRTRIHCPGFNKQ-VGLLTNLK 113 Query: 430 FENR 419 FENR Sbjct: 114 FENR 117 >SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/29 (68%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = +1 Query: 604 QQDGGHGSRNPLRXC-TTHLPKQPALKMD 687 QQDGGHG + C TTHLPKQ ALKMD Sbjct: 2 QQDGGHGKLESAKECVTTHLPKQLALKMD 30 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 42.7 bits (96), Expect = 3e-04 Identities = 20/31 (64%), Positives = 22/31 (70%) Frame = +1 Query: 550 KAPKKRSWDTMKGVGRS*QQDGGHGSRNPLR 642 + +RS D KGVG S QQDGGHGS NPLR Sbjct: 10 RCQSRRSSDPTKGVGCSRQQDGGHGSWNPLR 40 >SB_7775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = -3 Query: 244 ESLRSSIRVSPDFDLTRHSSPSFGSQHLCS 155 ESLR+S RVS F L RHSSPSFGSQ + S Sbjct: 35 ESLRASTRVSSGFTLFRHSSPSFGSQQMRS 64 >SB_29359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 33 Score = 40.3 bits (90), Expect = 0.001 Identities = 20/25 (80%), Positives = 21/25 (84%) Frame = +2 Query: 563 NAHGTP*KALVAHDSRTVAMEVGIR 637 +AH TP K LVA DSRTVAMEVGIR Sbjct: 9 DAHQTPQKVLVALDSRTVAMEVGIR 33 >SB_19053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 39.9 bits (89), Expect = 0.002 Identities = 24/57 (42%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = -2 Query: 596 RPTPFMVSHERFLGALNYVWFIPQ-RQFCLQNWPTWHRHQISGFIVRVSRSSHPFKV 429 +PTPF+ S ER L LN + + Q WPT + H +SGF SR+S+ FKV Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGFNY-ASRTSYQFKV 57 >SB_11440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 37.9 bits (84), Expect = 0.008 Identities = 20/45 (44%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = -2 Query: 599 ERPTPFMVSHERFLGALNYVWFIPQ-RQFCLQNWPTWHRHQISGF 468 E+PTPF+ S ER L LN + + LQ WPT + H +SGF Sbjct: 58 EQPTPFVGSDERRLWHLNRAFGSSRIASSALQKWPTRNSHSLSGF 102 >SB_6844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 37.1 bits (82), Expect = 0.013 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = -3 Query: 541 FGSSHSASSAYKIGPLGTVIRSPAS 467 FGSS ASSAY+ GPLGT I PAS Sbjct: 21 FGSSRIASSAYQNGPLGTRIHCPAS 45 >SB_59236| Best HMM Match : Attractin (HMM E-Value=8.2) Length = 125 Score = 37.1 bits (82), Expect = 0.013 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 3/54 (5%) Frame = -2 Query: 620 WPPSCCH--ERPTPFMVSHERFLGALNYVWFIPQ-RQFCLQNWPTWHRHQISGF 468 W P + E+PTPF+ S ER L LN + + Q WPT + H +SGF Sbjct: 71 WLPQASYPCEQPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 124 >SB_15603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 36.7 bits (81), Expect = 0.018 Identities = 19/46 (41%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = -2 Query: 602 HERPTPFMVSHERFLGALNYVWFIPQ-RQFCLQNWPTWHRHQISGF 468 +E+PTPF+ S ER L LN + + Q WPT + H +SGF Sbjct: 122 YEQPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 167 >SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 35.9 bits (79), Expect = 0.031 Identities = 19/45 (42%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = -2 Query: 599 ERPTPFMVSHERFLGALNYVWFIPQ-RQFCLQNWPTWHRHQISGF 468 E+PTPF+ S ER L LN + + Q WPT + H +SGF Sbjct: 41 EQPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 85 >SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 35.9 bits (79), Expect = 0.031 Identities = 19/45 (42%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = -2 Query: 599 ERPTPFMVSHERFLGALNYVWFIPQ-RQFCLQNWPTWHRHQISGF 468 E+PTPF+ S ER L LN + + Q WPT + H +SGF Sbjct: 38 EQPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 82 >SB_20448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 35.9 bits (79), Expect = 0.031 Identities = 19/45 (42%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = -2 Query: 599 ERPTPFMVSHERFLGALNYVWFIPQ-RQFCLQNWPTWHRHQISGF 468 E+PTPF+ S ER L LN + + Q WPT + H +SGF Sbjct: 39 EQPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 83 >SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 35.9 bits (79), Expect = 0.031 Identities = 19/45 (42%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = -2 Query: 599 ERPTPFMVSHERFLGALNYVWFIPQ-RQFCLQNWPTWHRHQISGF 468 E+PTPF+ S ER L LN + + Q WPT + H +SGF Sbjct: 39 EQPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTSNSHSLSGF 83 >SB_19187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 35.5 bits (78), Expect = 0.041 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = -2 Query: 596 RPTPFMVSHERFLGALNYVWFIPQ-RQFCLQNWPTWHRHQISGF 468 +PTPF+ S ER L LN+ + + Q WPT + H +SGF Sbjct: 2 QPTPFVGSDERRLWHLNHAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 34.3 bits (75), Expect = 0.094 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -2 Query: 596 RPTPFMVSHERFLGALNYVWFIPQ-RQFCLQNWPTWHRHQISGF 468 +PTPF+ S ER L LN + + Q WPT + H +SGF Sbjct: 2 QPTPFVGSDERRLWHLNRAYGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_32500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 33.9 bits (74), Expect = 0.12 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -2 Query: 596 RPTPFMVSHERFLGALNYVWFIPQ-RQFCLQNWPTWHRHQISGF 468 +PTPF+ S ER L LN + + Q WPT + H +SGF Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_24543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 33.9 bits (74), Expect = 0.12 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -2 Query: 596 RPTPFMVSHERFLGALNYVWFIPQ-RQFCLQNWPTWHRHQISGF 468 +PTPF+ S ER L LN + + Q WPT + H +SGF Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_5288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 33.9 bits (74), Expect = 0.12 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -2 Query: 596 RPTPFMVSHERFLGALNYVWFIPQ-RQFCLQNWPTWHRHQISGF 468 +PTPF+ S ER L LN + + Q WPT + H +SGF Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_4968| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 33.9 bits (74), Expect = 0.12 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -2 Query: 596 RPTPFMVSHERFLGALNYVWFIPQ-RQFCLQNWPTWHRHQISGF 468 +PTPF+ S ER L LN + + Q WPT + H +SGF Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_3995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 33.9 bits (74), Expect = 0.12 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -2 Query: 596 RPTPFMVSHERFLGALNYVWFIPQ-RQFCLQNWPTWHRHQISGF 468 +PTPF+ S ER L LN + + Q WPT + H +SGF Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTKNSHSLSGF 45 >SB_1350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 33.9 bits (74), Expect = 0.12 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -2 Query: 596 RPTPFMVSHERFLGALNYVWFIPQ-RQFCLQNWPTWHRHQISGF 468 +PTPF+ S ER L LN + + Q WPT + H +SGF Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_53668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 33.9 bits (74), Expect = 0.12 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -2 Query: 596 RPTPFMVSHERFLGALNYVWFIPQ-RQFCLQNWPTWHRHQISGF 468 +PTPF+ S ER L LN + + Q WPT + H +SGF Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_53194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 33.9 bits (74), Expect = 0.12 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -2 Query: 596 RPTPFMVSHERFLGALNYVWFIPQ-RQFCLQNWPTWHRHQISGF 468 +PTPF+ S ER L LN + + Q WPT + H +SGF Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_47973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 33.9 bits (74), Expect = 0.12 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -2 Query: 596 RPTPFMVSHERFLGALNYVWFIPQ-RQFCLQNWPTWHRHQISGF 468 +PTPF+ S ER L LN + + Q WPT + H +SGF Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_40285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 33.9 bits (74), Expect = 0.12 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -2 Query: 596 RPTPFMVSHERFLGALNYVWFIPQ-RQFCLQNWPTWHRHQISGF 468 +PTPF+ S ER L LN + + Q WPT + H +SGF Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_16426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 33.9 bits (74), Expect = 0.12 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -2 Query: 596 RPTPFMVSHERFLGALNYVWFIPQ-RQFCLQNWPTWHRHQISGF 468 +PTPF+ S ER L LN + + Q WPT + H +SGF Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 33.1 bits (72), Expect = 0.22 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -1 Query: 243 NRYGPPSGFPLTST*PGIVHH 181 NRY PP FPL S GIVHH Sbjct: 1 NRYEPPPEFPLASPYSGIVHH 21 >SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) Length = 212 Score = 32.3 bits (70), Expect = 0.38 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 603 TAGRWPWKSESAK 641 TAGRWPWK ESAK Sbjct: 1 TAGRWPWKLESAK 13 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 649 TTHLPKQPALKMD 687 TTHLPKQ ALKMD Sbjct: 17 TTHLPKQLALKMD 29 >SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 32.3 bits (70), Expect = 0.38 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 603 TAGRWPWKSESAK 641 TAGRWPWK ESAK Sbjct: 1 TAGRWPWKLESAK 13 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 649 TTHLPKQPALKMD 687 TTHLPKQ ALKMD Sbjct: 17 TTHLPKQLALKMD 29 >SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 32.3 bits (70), Expect = 0.38 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 603 TAGRWPWKSESAK 641 TAGRWPWK ESAK Sbjct: 80 TAGRWPWKLESAK 92 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 649 TTHLPKQPALKMD 687 TTHLPKQ ALKMD Sbjct: 96 TTHLPKQLALKMD 108 >SB_1848| Best HMM Match : Galactosyl_T (HMM E-Value=1.4e-26) Length = 308 Score = 29.1 bits (62), Expect = 3.5 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +1 Query: 163 NAGTRKMVNYAWSGRSQGKP*WRTVAILTCNRSSE 267 NA RK + + W P WRTV ++ N + E Sbjct: 75 NAARRKEIRFTWGTDFLPSPRWRTVFLIGANDNQE 109 >SB_54195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 370 Score = 28.7 bits (61), Expect = 4.7 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +1 Query: 163 NAGTRKMVNYAWSGRSQGKP*WRTVAILTCNRSSE 267 NA RK + + W P WRTV ++ N + E Sbjct: 79 NAARRKEIRFTWGTDFLPTPRWRTVFLIGANDNQE 113 >SB_40592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 28.7 bits (61), Expect = 4.7 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = -2 Query: 596 RPTPFMVSHERFLGALNYVWFIPQ-RQFCLQNWPTWHRHQISGF 468 +PTPF+ S ER L LN + + Q PT + H +SGF Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKGPTRNSHSLSGF 45 >SB_36629| Best HMM Match : Fer2 (HMM E-Value=0.0041) Length = 128 Score = 28.7 bits (61), Expect = 4.7 Identities = 16/51 (31%), Positives = 31/51 (60%), Gaps = 4/51 (7%) Frame = +3 Query: 111 LPRRLVSNQ*MKARSEHKC----WDPKDGELCLVRSKSGETLMEDRSDSDV 251 L RR VSN + +++H+ + +DG+ V++K G++L++ D+DV Sbjct: 29 LARRYVSNGKEQTKAKHETVSITFVDRDGDRQTVKAKVGDSLLDVAKDNDV 79 >SB_58055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 649 TTHLPKQPALKMD 687 TTHLPKQ ALKMD Sbjct: 11 TTHLPKQLALKMD 23 >SB_55300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 649 TTHLPKQPALKMD 687 TTHLPKQ ALKMD Sbjct: 11 TTHLPKQLALKMD 23 >SB_54389| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 649 TTHLPKQPALKMD 687 TTHLPKQ ALKMD Sbjct: 11 TTHLPKQLALKMD 23 >SB_53216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 649 TTHLPKQPALKMD 687 TTHLPKQ ALKMD Sbjct: 11 TTHLPKQLALKMD 23 >SB_51835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 649 TTHLPKQPALKMD 687 TTHLPKQ ALKMD Sbjct: 11 TTHLPKQLALKMD 23 >SB_49224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 649 TTHLPKQPALKMD 687 TTHLPKQ ALKMD Sbjct: 11 TTHLPKQLALKMD 23 >SB_48809| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 649 TTHLPKQPALKMD 687 TTHLPKQ ALKMD Sbjct: 11 TTHLPKQLALKMD 23 >SB_41857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 649 TTHLPKQPALKMD 687 TTHLPKQ ALKMD Sbjct: 11 TTHLPKQLALKMD 23 >SB_40886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 649 TTHLPKQPALKMD 687 TTHLPKQ ALKMD Sbjct: 11 TTHLPKQLALKMD 23 >SB_40435| Best HMM Match : DUF1677 (HMM E-Value=4.2) Length = 93 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 649 TTHLPKQPALKMD 687 TTHLPKQ ALKMD Sbjct: 11 TTHLPKQLALKMD 23 >SB_27787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 649 TTHLPKQPALKMD 687 TTHLPKQ ALKMD Sbjct: 17 TTHLPKQLALKMD 29 >SB_27353| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 649 TTHLPKQPALKMD 687 TTHLPKQ ALKMD Sbjct: 11 TTHLPKQLALKMD 23 >SB_24856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 649 TTHLPKQPALKMD 687 TTHLPKQ ALKMD Sbjct: 11 TTHLPKQLALKMD 23 >SB_16637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 649 TTHLPKQPALKMD 687 TTHLPKQ ALKMD Sbjct: 11 TTHLPKQLALKMD 23 >SB_9214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 649 TTHLPKQPALKMD 687 TTHLPKQ ALKMD Sbjct: 11 TTHLPKQLALKMD 23 >SB_5959| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 649 TTHLPKQPALKMD 687 TTHLPKQ ALKMD Sbjct: 11 TTHLPKQLALKMD 23 >SB_3984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 649 TTHLPKQPALKMD 687 TTHLPKQ ALKMD Sbjct: 11 TTHLPKQLALKMD 23 >SB_47626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 649 TTHLPKQPALKMD 687 TTHLPKQ ALKMD Sbjct: 17 TTHLPKQLALKMD 29 >SB_23657| Best HMM Match : Sushi (HMM E-Value=0) Length = 331 Score = 27.9 bits (59), Expect = 8.1 Identities = 17/62 (27%), Positives = 25/62 (40%) Frame = +3 Query: 144 KARSEHKCWDPKDGELCLVRSKSGETLMEDRSDSDVQSIVGTGYRGERLIEPSSSWFRPK 323 K + + +CW PK V SKSG+ + +Q GT G + + P Sbjct: 210 KPKCKRRCWVPKPPLRGQVLSKSGKDYAKHGEHLRIQCNSGTDAVGPSQSQCKDGRWSPN 269 Query: 324 FP 329 FP Sbjct: 270 FP 271 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,724,809 Number of Sequences: 59808 Number of extensions: 475321 Number of successful extensions: 1116 Number of sequences better than 10.0: 57 Number of HSP's better than 10.0 without gapping: 978 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1064 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -