BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0115 (593 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB24D3.09c |pdr1||ABC transporter Pdr1|Schizosaccharomyces po... 27 2.1 SPBC1604.02c |||PPR repeat protein|Schizosaccharomyces pombe|chr... 26 3.6 SPAC27D7.14c |tpr1|SPAC637.02c|RNA polymerase II associated Paf1... 26 3.6 SPAC23H3.02c |ini1||RING finger-like protein Ini1|Schizosaccharo... 25 8.3 >SPAPB24D3.09c |pdr1||ABC transporter Pdr1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1396 Score = 27.1 bits (57), Expect = 2.1 Identities = 12/29 (41%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = -2 Query: 103 LANFVRNDRKSRH-RRIKKQRRYERLAAT 20 LANF+R DR+S H +K++ Y ++A++ Sbjct: 696 LANFIRYDRESVHIPEFQKRKSYSQVASS 724 >SPBC1604.02c |||PPR repeat protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 697 Score = 26.2 bits (55), Expect = 3.6 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +2 Query: 20 CGSQAFIATLLFDPSMSALPIIANKIRQAL 109 CGS I +LF S S L + KI Q L Sbjct: 511 CGSSPAIKLILFSKSFSVLQSTSEKIEQLL 540 >SPAC27D7.14c |tpr1|SPAC637.02c|RNA polymerase II associated Paf1 complex subunit Tpr1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1039 Score = 26.2 bits (55), Expect = 3.6 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 287 GW*FAPPAARPVHEPNVRNCGSS 219 GW + RPV +P VR+C + Sbjct: 588 GWYLSKQKRRPVEDPEVRHCSQT 610 >SPAC23H3.02c |ini1||RING finger-like protein Ini1|Schizosaccharomyces pombe|chr 1|||Manual Length = 117 Score = 25.0 bits (52), Expect = 8.3 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -1 Query: 245 PNVRNCGSSRTEQYYYRNDKPSVG 174 P V N GSSRT+ +Y R + G Sbjct: 86 PRVINLGSSRTDWFYERKKFKNAG 109 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,441,386 Number of Sequences: 5004 Number of extensions: 49445 Number of successful extensions: 127 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 123 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 127 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 258201856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -