BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0112 (679 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U41994-9|AAK31523.1| 786|Caenorhabditis elegans Hypothetical pr... 30 1.3 AL132847-1|CAB63371.1| 375|Caenorhabditis elegans Hypothetical ... 28 7.0 >U41994-9|AAK31523.1| 786|Caenorhabditis elegans Hypothetical protein F59A6.3 protein. Length = 786 Score = 30.3 bits (65), Expect = 1.3 Identities = 22/75 (29%), Positives = 31/75 (41%), Gaps = 2/75 (2%) Frame = -1 Query: 310 GSCTRPSGRW--CEATIRGIILNASKAETSLAESGKDMLTVEPRESGGSKQCDFTSRVSH 137 G+C+ PS W C T + + TSL S D + EPR S + D T+ Sbjct: 92 GACSDPSPVWTNCTETTSTASTEFTISSTSLKTSTSDSTSTEPRISTTTDTKDTTTEDPV 151 Query: 136 SKRETRRRSPFGSRR 92 S + SP + R Sbjct: 152 SSTDQSSTSPHETTR 166 >AL132847-1|CAB63371.1| 375|Caenorhabditis elegans Hypothetical protein Y48G10A.2 protein. Length = 375 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/51 (21%), Positives = 28/51 (54%) Frame = -1 Query: 271 TIRGIILNASKAETSLAESGKDMLTVEPRESGGSKQCDFTSRVSHSKRETR 119 +++G I + + ++ K ++ EP+E+ + D+ + ++HSK E + Sbjct: 306 SLKGQIKSENYTSIAVTRLYKMLIRTEPKETALRRAADYLNELTHSKTEKK 356 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,547,159 Number of Sequences: 27780 Number of extensions: 310380 Number of successful extensions: 829 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 793 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 829 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1539654388 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -