BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0110 (490 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_05_0136 - 22631260-22631325,22631735-22631821,22631898-226320... 28 4.6 11_06_0661 - 26009838-26010950,26011302-26011802 27 8.1 >05_05_0136 - 22631260-22631325,22631735-22631821,22631898-22632026, 22632122-22632190,22632271-22632351,22632598-22632702, 22632786-22633016,22633098-22634272,22634391-22634457, 22636705-22637778,22638119-22638274,22638827-22638985, 22639062-22639220,22639306-22639422,22639502-22639612, 22639690-22640358 Length = 1484 Score = 27.9 bits (59), Expect = 4.6 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +3 Query: 231 MEDRSDSDCKSIVGTGYRGERLIEPSSSWVRPKFP 335 +E S DCKS YRG R+ + + + P +P Sbjct: 1260 LESSSSGDCKSTSDLSYRGCRIEDLAIEFALPGYP 1294 >11_06_0661 - 26009838-26010950,26011302-26011802 Length = 537 Score = 27.1 bits (57), Expect = 8.1 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -2 Query: 192 HHLSGPSICAQSAPSFTDWK 133 HHL GP+ + S+P WK Sbjct: 297 HHLHGPTSSSSSSPVMASWK 316 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,795,991 Number of Sequences: 37544 Number of extensions: 270430 Number of successful extensions: 484 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 479 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 484 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1011709100 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -