BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0110 (490 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13467| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_7775| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.29 SB_1848| Best HMM Match : Galactosyl_T (HMM E-Value=1.4e-26) 31 0.67 SB_54195| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.89 SB_6393| Best HMM Match : 7tm_1 (HMM E-Value=2.1e-28) 28 3.6 SB_46486| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=0.7) 28 3.6 SB_34438| Best HMM Match : Ribosomal_L23eN (HMM E-Value=2) 27 8.3 >SB_13467| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 38 Score = 44.8 bits (101), Expect = 4e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -2 Query: 249 NRYGPPSGFPLTAT*PGIVHHLSGPSICA 163 NRY PP FPL + GIVHHLSGP+ CA Sbjct: 1 NRYEPPPEFPLASPYSGIVHHLSGPNRCA 29 >SB_7775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 39.9 bits (89), Expect = 0.001 Identities = 24/44 (54%), Positives = 30/44 (68%) Frame = -1 Query: 250 ESLRSSIRVSPDCDLTRHSSPSFGSQHLCSERAFIH*LETSRLG 119 ESLR+S RVS L RHSSPSFGSQ + R++ + L SR+G Sbjct: 35 ESLRASTRVSSGFTLFRHSSPSFGSQQM---RSYSN-LSKSRIG 74 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 31.9 bits (69), Expect = 0.29 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = -2 Query: 249 NRYGPPSGFPLTAT*PGIVHH 187 NRY PP FPL + GIVHH Sbjct: 1 NRYEPPPEFPLASPYSGIVHH 21 >SB_1848| Best HMM Match : Galactosyl_T (HMM E-Value=1.4e-26) Length = 308 Score = 30.7 bits (66), Expect = 0.67 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 169 NAGTRKMVNYAWSGRSQGKP*WRTVAILTANRSSE 273 NA RK + + W P WRTV ++ AN + E Sbjct: 75 NAARRKEIRFTWGTDFLPSPRWRTVFLIGANDNQE 109 >SB_54195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 370 Score = 30.3 bits (65), Expect = 0.89 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 169 NAGTRKMVNYAWSGRSQGKP*WRTVAILTANRSSE 273 NA RK + + W P WRTV ++ AN + E Sbjct: 79 NAARRKEIRFTWGTDFLPTPRWRTVFLIGANDNQE 113 >SB_6393| Best HMM Match : 7tm_1 (HMM E-Value=2.1e-28) Length = 307 Score = 28.3 bits (60), Expect = 3.6 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -2 Query: 195 VHHLSGPSICAQSAPSFTDWKRAASGVRKSR 103 V L+ S+C Q APSF + K+ AS VR ++ Sbjct: 183 VRKLAKISLCDQYAPSFKEKKKMASEVRVAK 213 >SB_46486| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=0.7) Length = 703 Score = 28.3 bits (60), Expect = 3.6 Identities = 16/60 (26%), Positives = 31/60 (51%), Gaps = 2/60 (3%) Frame = +3 Query: 156 RSEHKCWDPKD--GELCLVRSQSGETLMEDRSDSDCKSIVGTGYRGERLIEPSSSWVRPK 329 +++ C D ++ GE ++S +T D S + C+S++ TG + L + S RP+ Sbjct: 303 QNDLSCSDSENEGGESFSTTAKSKDTKANDYSMTSCRSVLATGLNEQSLAKRKESIRRPE 362 >SB_34438| Best HMM Match : Ribosomal_L23eN (HMM E-Value=2) Length = 772 Score = 27.1 bits (57), Expect = 8.3 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = -3 Query: 332 KLRTDPATRWFD*SFAPIPSSDDRFAVRIATVLHQGFP 219 K DP+++ F F IPS +D+ A+ + + LH+ P Sbjct: 28 KALDDPSSQ-FGNDFKAIPSEEDKRAMHLQSALHRSEP 64 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,418,737 Number of Sequences: 59808 Number of extensions: 302715 Number of successful extensions: 1335 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1293 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1335 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1038380485 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -