BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0110 (490 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 24 1.00 D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 22 4.0 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 22 4.0 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 7.0 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 23.8 bits (49), Expect = 1.00 Identities = 17/52 (32%), Positives = 25/52 (48%) Frame = -1 Query: 484 SPASSFE*AGVLTHLKFENRLRSFRPKCL*SCALPDETVLKFYIDASYPEGN 329 S A+S E + TH + ++LR R S L DE K + ++ EGN Sbjct: 220 STAASDEDISLTTHQQKRHKLRVTRCYSSDSAVLSDEDQTKGWDGSNMVEGN 271 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.8 bits (44), Expect = 4.0 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -1 Query: 292 LSPLYPVPTID 260 LSP+YP P +D Sbjct: 71 LSPIYPSPMVD 81 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.8 bits (44), Expect = 4.0 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -1 Query: 292 LSPLYPVPTID 260 LSP+YP P +D Sbjct: 71 LSPIYPSPMVD 81 Score = 20.6 bits (41), Expect = 9.3 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -2 Query: 279 TQFRRSICSQNRYGPPSGFP 220 + F++ I + Y PPSG P Sbjct: 321 SDFKKLIDNWMTYMPPSGIP 340 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.0 bits (42), Expect = 7.0 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +3 Query: 294 LIEPSSSWVRPKFPS 338 + EP S VRPKFPS Sbjct: 202 ITEPVGS-VRPKFPS 215 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 130,437 Number of Sequences: 438 Number of extensions: 3050 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13421061 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -