BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0106 (711 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 25 2.3 AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. 24 4.1 DQ370037-1|ABD18598.1| 121|Anopheles gambiae putative TIL domai... 23 9.5 AJ697721-1|CAG26914.1| 135|Anopheles gambiae putative odorant-b... 23 9.5 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 25.0 bits (52), Expect = 2.3 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = -2 Query: 575 PLNGGRTESCRSRTKRNRHDLRQEDPRKAGERGSGSSPKR 456 P +GGR SCRS R R R P S PKR Sbjct: 262 PRSGGRWPSCRSPPARRRS--RSTRPTSWPRSRPTSKPKR 299 >AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. Length = 1187 Score = 24.2 bits (50), Expect = 4.1 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -2 Query: 533 KRNRHDLRQEDPRKAGER 480 K R+D +EDP++AG + Sbjct: 949 KNTRYDYNKEDPQEAGRK 966 >DQ370037-1|ABD18598.1| 121|Anopheles gambiae putative TIL domain polypeptide protein. Length = 121 Score = 23.0 bits (47), Expect = 9.5 Identities = 8/27 (29%), Positives = 13/27 (48%) Frame = -1 Query: 156 PSPEFSRSAESIRTPPQMRCSSRSEPY 76 P P + + E PP++ C+ E Y Sbjct: 39 PEPSTTEATEEESPPPKIECTDPREVY 65 >AJ697721-1|CAG26914.1| 135|Anopheles gambiae putative odorant-binding protein OBPjj11 protein. Length = 135 Score = 23.0 bits (47), Expect = 9.5 Identities = 11/31 (35%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +3 Query: 591 HGQGESDCLI-KTKHCDGPRGC*RNVISAQC 680 +GQ ++D L+ + ++ DGP C R+ QC Sbjct: 95 YGQEKADELVARCRNNDGPDACERSFRLLQC 125 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 822,338 Number of Sequences: 2352 Number of extensions: 17465 Number of successful extensions: 43 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 41 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 43 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 72758970 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -