BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0103 (685 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|c... 29 0.63 SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe... 29 0.63 SPBC32F12.04 |tug1|gtb1|gamma-tubulin|Schizosaccharomyces pombe|... 26 5.8 SPAC5D6.07c |||PXA domain protein|Schizosaccharomyces pombe|chr ... 26 5.8 SPCC1393.04 |fta4|sma6|Sim4 and Mal2 associated |Schizosaccharom... 25 7.7 >SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1142 Score = 29.1 bits (62), Expect = 0.63 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +1 Query: 37 SGCGRCRVWSMFVRYVRFSE 96 +GCG+ VW +VR+V F E Sbjct: 108 NGCGKSYVWPSYVRFVDFDE 127 >SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 410 Score = 29.1 bits (62), Expect = 0.63 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -3 Query: 221 ARKIRGRPENAGPDPVRNVRRFSRV 147 AR I GRPEN G ++N+ R S+V Sbjct: 214 ARTIPGRPENGGNCDIKNLSRGSKV 238 >SPBC32F12.04 |tug1|gtb1|gamma-tubulin|Schizosaccharomyces pombe|chr 2|||Manual Length = 446 Score = 25.8 bits (54), Expect = 5.8 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 479 RIRARYPKRVIVTPAVYPRLLEFLHVDIQ 393 R+ RYPK++I T +V+P V +Q Sbjct: 156 RLNDRYPKKIIQTYSVFPNSQSVSDVVVQ 184 >SPAC5D6.07c |||PXA domain protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 495 Score = 25.8 bits (54), Expect = 5.8 Identities = 15/58 (25%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Frame = -3 Query: 323 SRIPLVRASSELTVERRS-YRIVPSRTKRNRHDLTARKIRGRPENAGPDPVRNVRRFS 153 + + R S+ + RRS YR S + ++ ++L+ K + P + P P+ N+ + S Sbjct: 298 TNVTTFRRFSQSSYPRRSNYRRRISTSSKSLYELSPSKFKSIPITSNPPPMLNLSKGS 355 >SPCC1393.04 |fta4|sma6|Sim4 and Mal2 associated |Schizosaccharomyces pombe|chr 3|||Manual Length = 233 Score = 25.4 bits (53), Expect = 7.7 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -3 Query: 74 TNIDQTRHRPHPLPVQTRHAPV 9 +N+D + PHP P Q PV Sbjct: 100 SNLDSVKSLPHPWPFQKESRPV 121 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,696,479 Number of Sequences: 5004 Number of extensions: 51346 Number of successful extensions: 136 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 134 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 136 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 315915086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -