BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0103 (685 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) 77 1e-14 SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_30962| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_20773| Best HMM Match : DNA_pol_B_exo (HMM E-Value=2.5e-37) 77 1e-14 SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) 77 1e-14 SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_52557| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_51064| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_48482| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_47507| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_46751| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_42028| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_40596| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_39544| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_39345| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) 77 1e-14 SB_37260| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_35695| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_35230| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_35048| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_34691| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_34125| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_32443| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_29553| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_29380| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_23079| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_22871| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_22715| Best HMM Match : SAM_PNT (HMM E-Value=1.8) 77 1e-14 SB_21148| Best HMM Match : PAN (HMM E-Value=0.49) 77 1e-14 SB_19464| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_18801| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_18037| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_17135| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_16602| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_16324| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_16101| Best HMM Match : RVT_1 (HMM E-Value=0.00031) 77 1e-14 SB_15175| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_15145| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_14442| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_10623| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_8423| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_7697| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_7274| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_5755| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_42131| Best HMM Match : 7tm_1 (HMM E-Value=8.5e-35) 63 2e-10 SB_13397| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_10695| Best HMM Match : Pollen_Ole_e_I (HMM E-Value=5.2) 49 3e-06 SB_7317| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_15857| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_30687| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_32812| Best HMM Match : CfAFP (HMM E-Value=9.5) 47 2e-05 SB_2599| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) 46 2e-05 SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) 46 3e-05 SB_19841| Best HMM Match : Myb_DNA-binding (HMM E-Value=1.1) 46 3e-05 SB_15771| Best HMM Match : VQ (HMM E-Value=4.3) 46 3e-05 SB_857| Best HMM Match : Mago_nashi (HMM E-Value=0) 46 3e-05 SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) 45 5e-05 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_23874| Best HMM Match : SSIII (HMM E-Value=5.4) 45 5e-05 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 45 5e-05 SB_58947| Best HMM Match : Helicase_C (HMM E-Value=0.058) 45 7e-05 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_47984| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_43222| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) 44 9e-05 SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_58459| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) 44 9e-05 SB_58084| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_55949| Best HMM Match : FLYWCH (HMM E-Value=0.16) 44 9e-05 SB_55180| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) 44 9e-05 SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) 44 9e-05 SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_45733| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_45470| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) 44 9e-05 SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) 44 9e-05 SB_39953| Best HMM Match : Ank (HMM E-Value=1.8e-19) 44 9e-05 SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) 44 9e-05 SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) 44 9e-05 SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_35652| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) 44 9e-05 SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_30841| Best HMM Match : HLH (HMM E-Value=1.5) 44 9e-05 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_28553| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_26370| Best HMM Match : Drf_FH1 (HMM E-Value=5.2) 44 9e-05 SB_26141| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_25318| Best HMM Match : fn3 (HMM E-Value=2e-15) 44 9e-05 SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) 44 9e-05 SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_23451| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) 44 9e-05 SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_20654| Best HMM Match : Helicase_C (HMM E-Value=2.3e-21) 44 9e-05 SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) 44 9e-05 SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_19176| Best HMM Match : YGGT (HMM E-Value=1.1) 44 9e-05 SB_18680| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 44 9e-05 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) 44 9e-05 SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) 44 9e-05 SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) 44 9e-05 SB_10646| Best HMM Match : GPW_gp25 (HMM E-Value=5.8) 44 9e-05 SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) 44 9e-05 SB_3614| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_1174| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) 44 9e-05 SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_56924| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_55232| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) 44 9e-05 SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3) 44 9e-05 SB_52605| Best HMM Match : UPF0004 (HMM E-Value=3.6) 44 9e-05 SB_52560| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_51037| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_49985| Best HMM Match : RuvB_C (HMM E-Value=3.6) 44 9e-05 SB_49124| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_48664| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_47765| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_47738| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_47238| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_45871| Best HMM Match : ABC_tran (HMM E-Value=2.5e-08) 44 9e-05 SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_45393| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.088) 44 9e-05 SB_44008| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_43854| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.7) 44 9e-05 SB_43776| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_43062| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_42773| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_42727| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_40658| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_40501| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_40404| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_39352| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_39336| Best HMM Match : Kinesin (HMM E-Value=0) 44 9e-05 SB_39081| Best HMM Match : Pertussis_S2S3 (HMM E-Value=9.8) 44 9e-05 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_38298| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_37805| Best HMM Match : DoxA (HMM E-Value=1.7) 44 9e-05 SB_36672| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_36066| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_35778| Best HMM Match : Dickkopf_N (HMM E-Value=2.4) 44 9e-05 SB_35502| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_35393| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 44 9e-05 SB_34374| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_34337| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) 44 9e-05 SB_34031| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_33205| Best HMM Match : Mucin (HMM E-Value=0.0024) 44 9e-05 SB_32541| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_31524| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_31275| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_29812| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_29441| Best HMM Match : MFS_1 (HMM E-Value=1.6e-12) 44 9e-05 SB_29161| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 44 9e-05 SB_27070| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_26894| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_24394| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_22691| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_21601| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 44 9e-05 SB_21132| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_20517| Best HMM Match : Nuclease_act (HMM E-Value=1.4) 44 9e-05 SB_20344| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_20082| Best HMM Match : DUF378 (HMM E-Value=4.1) 44 9e-05 SB_18568| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.5e-22) 44 9e-05 SB_18544| Best HMM Match : 7tm_1 (HMM E-Value=0.00082) 44 9e-05 SB_16764| Best HMM Match : ACPS (HMM E-Value=4.4) 44 9e-05 SB_16421| Best HMM Match : HD-ZIP_N (HMM E-Value=7.6) 44 9e-05 SB_16384| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.1) 44 9e-05 SB_16112| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_15218| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_14808| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_11965| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_11390| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_11195| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_10723| Best HMM Match : Chromo (HMM E-Value=0.031) 44 9e-05 SB_10325| Best HMM Match : ubiquitin (HMM E-Value=3.4e-05) 44 9e-05 SB_9384| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_9135| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_8821| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_8316| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_8089| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_6860| Best HMM Match : zf-C3HC4 (HMM E-Value=0.14) 44 9e-05 SB_6458| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_6008| Best HMM Match : CPSase_L_D2 (HMM E-Value=0) 44 9e-05 SB_5051| Best HMM Match : DUF1193 (HMM E-Value=0.88) 44 9e-05 SB_4934| Best HMM Match : NAD_binding_2 (HMM E-Value=4.8) 44 9e-05 SB_4559| Best HMM Match : ICAM_N (HMM E-Value=5.3) 44 9e-05 SB_3948| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_3585| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_3444| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_3301| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_742| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) 44 1e-04 SB_54325| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_6296| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_5310| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_25766| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_11908| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_13637| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_35826| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) 43 3e-04 SB_39083| Best HMM Match : PhaC_N (HMM E-Value=0.7) 43 3e-04 SB_37138| Best HMM Match : RnaseA (HMM E-Value=8) 43 3e-04 SB_9528| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-39) 43 3e-04 SB_32223| Best HMM Match : SH3BP5 (HMM E-Value=0.12) 42 4e-04 SB_3664| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_57559| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_32717| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_16777| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 42 4e-04 SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) 42 5e-04 SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) 42 5e-04 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 42 5e-04 SB_37689| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_32162| Best HMM Match : Ras (HMM E-Value=4.7e-31) 42 5e-04 SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_58955| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_54223| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_50207| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) 42 6e-04 SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) 42 6e-04 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 42 6e-04 SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_45312| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_42593| Best HMM Match : Rho_GDI (HMM E-Value=3.7e-17) 42 6e-04 SB_40754| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_37089| Best HMM Match : Ribosomal_S9 (HMM E-Value=9.9) 42 6e-04 SB_35341| Best HMM Match : Acyl-CoA_dh_M (HMM E-Value=2.9e-14) 42 6e-04 SB_32231| Best HMM Match : PRKCSH (HMM E-Value=4.3e-12) 42 6e-04 SB_31888| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_26519| Best HMM Match : DUF1242 (HMM E-Value=8.7) 42 6e-04 SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) 42 6e-04 SB_24381| Best HMM Match : MMR_HSR1 (HMM E-Value=2) 42 6e-04 SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) 42 6e-04 SB_20958| Best HMM Match : Peptidase_C15 (HMM E-Value=0.001) 42 6e-04 SB_15247| Best HMM Match : Hormone_5 (HMM E-Value=0.98) 42 6e-04 SB_15003| Best HMM Match : WAP (HMM E-Value=0.0036) 42 6e-04 SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) 42 6e-04 SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) 42 6e-04 SB_10448| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_10073| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) 42 6e-04 SB_2945| Best HMM Match : NADH_dehy_S2_C (HMM E-Value=4.4) 42 6e-04 SB_1908| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27) 42 6e-04 SB_56846| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_55386| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_51213| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 42 6e-04 SB_45253| Best HMM Match : ig (HMM E-Value=0.00016) 42 6e-04 SB_44687| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_39857| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) 42 6e-04 SB_36015| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_33325| Best HMM Match : ShTK (HMM E-Value=6.3e-10) 42 6e-04 SB_29112| Best HMM Match : Mucin (HMM E-Value=1.7) 42 6e-04 SB_27082| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_26697| Best HMM Match : EGF (HMM E-Value=7.5e-34) 42 6e-04 SB_26142| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_23046| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_18550| Best HMM Match : DUF987 (HMM E-Value=4.4) 42 6e-04 SB_17258| Best HMM Match : DUF791 (HMM E-Value=0.002) 42 6e-04 SB_16872| Best HMM Match : ARM_1 (HMM E-Value=0) 42 6e-04 SB_9530| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_9475| Best HMM Match : PAN (HMM E-Value=0.0022) 42 6e-04 SB_6524| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_5006| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_3953| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_3169| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_1434| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_59631| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_58783| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) 41 8e-04 SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_40593| Best HMM Match : UCH (HMM E-Value=1.4e-07) 41 8e-04 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 41 8e-04 SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) 41 8e-04 SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) 41 8e-04 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 41 8e-04 SB_19170| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_16558| Best HMM Match : SoxE (HMM E-Value=8.2) 41 8e-04 SB_15111| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) 41 8e-04 SB_5713| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_5443| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_53938| Best HMM Match : Gln-synt_N (HMM E-Value=0.78) 41 8e-04 SB_53936| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_50527| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_44336| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_36434| Best HMM Match : Ins_allergen_rp (HMM E-Value=5.7) 41 8e-04 SB_33876| Best HMM Match : EGF (HMM E-Value=2.4e-08) 41 8e-04 SB_28284| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_9823| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_6133| Best HMM Match : ABC_tran (HMM E-Value=9e-09) 41 8e-04 SB_870| Best HMM Match : 7tm_1 (HMM E-Value=5.3e-09) 41 8e-04 SB_49381| Best HMM Match : RuvB_C (HMM E-Value=8.2) 41 0.001 SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) 40 0.001 SB_30926| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_215| Best HMM Match : ALG3 (HMM E-Value=0.18) 40 0.001 SB_54599| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_864| Best HMM Match : Sulfotransfer_1 (HMM E-Value=6.4e-05) 40 0.001 SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_54224| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_53433| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) 40 0.002 SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 40 0.002 SB_47286| Best HMM Match : DUF485 (HMM E-Value=5.5) 40 0.002 SB_43936| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_39337| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_39248| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_34127| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) 40 0.002 SB_33112| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) 40 0.002 SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) 40 0.002 SB_31147| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) 40 0.002 SB_27029| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_26811| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_24858| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_21178| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_19974| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_16892| Best HMM Match : TIL (HMM E-Value=4.4) 40 0.002 SB_10549| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_9649| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_8444| Best HMM Match : BRE (HMM E-Value=6.4) 40 0.002 SB_8427| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_8298| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) 40 0.002 SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) 40 0.002 SB_2218| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_941| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_59622| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_59470| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_59436| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_59341| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_59321| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_58497| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_58355| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_58133| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_57986| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_57715| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_57590| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_57358| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_57221| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_56778| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_56683| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_56485| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_55971| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_55894| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_55772| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_55573| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_55419| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_55215| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.0003) 40 0.002 SB_55103| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_55047| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_54903| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_54851| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_54482| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_54385| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_53836| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_53493| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_53207| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_52948| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_52761| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_52662| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_52572| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_51972| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_51882| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_51677| Best HMM Match : DUF327 (HMM E-Value=0.89) 40 0.002 SB_51566| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_50879| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_50740| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_50537| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_50288| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_50212| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_49986| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_49737| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_49720| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_49154| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_48785| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_47297| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_46711| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_46514| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_46319| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_46282| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_46221| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_45973| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_45953| Best HMM Match : LRR_1 (HMM E-Value=7.4e-15) 40 0.002 SB_45744| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_45699| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_45621| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_45133| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_45037| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_44899| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_44633| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_44593| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_44213| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_44147| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_44009| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_43277| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_43007| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_42693| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_42249| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_42173| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_41969| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_41303| Best HMM Match : DUF485 (HMM E-Value=2) 40 0.002 SB_40919| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_40898| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_40785| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_40779| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_40759| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_40752| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.5) 40 0.002 SB_40215| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 >SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) Length = 346 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 436 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_30962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 733 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_20773| Best HMM Match : DNA_pol_B_exo (HMM E-Value=2.5e-37) Length = 1652 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) Length = 348 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_52557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_51064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_48482| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_47507| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 917 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_46751| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 400 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_42028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_40596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_39544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_39345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) Length = 846 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_37260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 818 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_35695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_35230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_35048| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_34691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_34125| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_32443| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_29553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 573 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_29380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_23079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_22871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_22715| Best HMM Match : SAM_PNT (HMM E-Value=1.8) Length = 996 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_21148| Best HMM Match : PAN (HMM E-Value=0.49) Length = 183 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_19464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1653 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_18801| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_18037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_17135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_16602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_16324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_16101| Best HMM Match : RVT_1 (HMM E-Value=0.00031) Length = 336 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_15175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_15145| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_14442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_10623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_8423| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_7697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_7274| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_5755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35 >SB_42131| Best HMM Match : 7tm_1 (HMM E-Value=8.5e-35) Length = 521 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -2 Query: 399 HSEHWAEITLRQHPRGPSQCFVLIRQSDSPCPCQF 295 ++EHWAEITLRQH PSQCFVLI+QSDSP CQF Sbjct: 48 NNEHWAEITLRQHRFRPSQCFVLIKQSDSPSHCQF 82 >SB_13397| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 513 Score = 50.0 bits (114), Expect = 2e-06 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -2 Query: 651 WHDRFPDWKAGSERNAINVS 592 WHDRFPDWKAGSERNAINV+ Sbjct: 190 WHDRFPDWKAGSERNAINVA 209 >SB_10695| Best HMM Match : Pollen_Ole_e_I (HMM E-Value=5.2) Length = 300 Score = 49.2 bits (112), Expect = 3e-06 Identities = 29/60 (48%), Positives = 34/60 (56%), Gaps = 3/60 (5%) Frame = +1 Query: 514 LSAHNSTQHTSRKHKV*SLGCLMSE---LTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 +S + QH S KHK + GC E + + T VGKPVVPAALMNRPTRGE Sbjct: 155 ISGEYAVQH-SCKHKAFTEGCKEPEGPKHRYFRRICCTTLLQVGKPVVPAALMNRPTRGE 213 >SB_7317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/25 (88%), Positives = 23/25 (92%) Frame = +3 Query: 510 IVIRSQFHTTYEPEA*SVKPGVPNE 584 IVIRS FHTTY+PEA SVKPGVPNE Sbjct: 65 IVIRSVFHTTYDPEAESVKPGVPNE 89 >SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 48.8 bits (111), Expect = 4e-06 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = +1 Query: 568 LGCLMSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 L C+ S++ I+ V L PVGKPVVPAALMNRPTRGE Sbjct: 22 LNCVPSKIKLIDTVDLEGG-PVGKPVVPAALMNRPTRGE 59 >SB_15857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 452 Score = 48.8 bits (111), Expect = 4e-06 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = +1 Query: 604 CVALTARFPVGKPVVPAALMNRPTRGE 684 C++ T F VGKPVVPAALMNRPTRGE Sbjct: 129 CISFTRIFRVGKPVVPAALMNRPTRGE 155 >SB_30687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 48.0 bits (109), Expect = 7e-06 Identities = 29/51 (56%), Positives = 35/51 (68%), Gaps = 1/51 (1%) Frame = +1 Query: 535 QHTSRKHKV*S-LGCLMSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 +H +RK K+ S L M ++ I+ V L PVGKPVVPAALMNRPTRGE Sbjct: 102 EHKTRKTKLLSTLPPRMRKIKLIDTVDLEGG-PVGKPVVPAALMNRPTRGE 151 >SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/31 (64%), Positives = 25/31 (80%) Frame = +1 Query: 592 THINCVALTARFPVGKPVVPAALMNRPTRGE 684 T +C+ ++ + VGKPVVPAALMNRPTRGE Sbjct: 27 TGFHCILVSFGYSVGKPVVPAALMNRPTRGE 57 >SB_32812| Best HMM Match : CfAFP (HMM E-Value=9.5) Length = 167 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = +3 Query: 387 SALNVNVKKFKQARVNGGSNYDSL 458 +ALNV VKKF QARVNGGSNYDSL Sbjct: 28 AALNVKVKKFNQARVNGGSNYDSL 51 >SB_2599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 46.8 bits (106), Expect = 2e-05 Identities = 24/37 (64%), Positives = 27/37 (72%) Frame = +1 Query: 574 CLMSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 C+ S + I+ V L PVGKPVVPAALMNRPTRGE Sbjct: 19 CMKSVIKLIDTVDLEGG-PVGKPVVPAALMNRPTRGE 54 >SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) Length = 453 Score = 46.4 bits (105), Expect = 2e-05 Identities = 23/36 (63%), Positives = 26/36 (72%) Frame = +1 Query: 577 LMSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 +M + + VA AR VGKPVVPAALMNRPTRGE Sbjct: 208 IMKKSGSVQIVAELAREYVGKPVVPAALMNRPTRGE 243 >SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) Length = 284 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = +1 Query: 610 ALTARFPVGKPVVPAALMNRPTRGE 684 A+ P+GKPVVPAALMNRPTRGE Sbjct: 173 AINTTLPIGKPVVPAALMNRPTRGE 197 >SB_19841| Best HMM Match : Myb_DNA-binding (HMM E-Value=1.1) Length = 753 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = +1 Query: 622 RFPVGKPVVPAALMNRPTRGE 684 R P+GKPVVPAALMNRPTRGE Sbjct: 212 RIPIGKPVVPAALMNRPTRGE 232 >SB_15771| Best HMM Match : VQ (HMM E-Value=4.3) Length = 145 Score = 46.0 bits (104), Expect = 3e-05 Identities = 25/48 (52%), Positives = 30/48 (62%) Frame = +1 Query: 541 TSRKHKV*SLGCLMSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 TSR+ L L++ ++ T R VGKPVVPAALMNRPTRGE Sbjct: 11 TSREFADMQLNPLVAHTILVHARTKTERTLVGKPVVPAALMNRPTRGE 58 >SB_857| Best HMM Match : Mago_nashi (HMM E-Value=0) Length = 900 Score = 46.0 bits (104), Expect = 3e-05 Identities = 21/38 (55%), Positives = 26/38 (68%) Frame = +1 Query: 571 GCLMSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 G L + + + +T + VGKPVVPAALMNRPTRGE Sbjct: 826 GALPEVIESLPRIKITTQHTVGKPVVPAALMNRPTRGE 863 >SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 45.6 bits (103), Expect = 4e-05 Identities = 27/56 (48%), Positives = 31/56 (55%), Gaps = 2/56 (3%) Frame = +1 Query: 523 HNSTQHTSRKHKV*SLGCLMSELTHINCVALT--ARFPVGKPVVPAALMNRPTRGE 684 +N T+H R V S+ T I + PVGKPVVPAALMNRPTRGE Sbjct: 4 YNCTRHIERNAAVSSIDNAKKIDTSIKLIDTVDLEGGPVGKPVVPAALMNRPTRGE 59 >SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) Length = 178 Score = 45.2 bits (102), Expect = 5e-05 Identities = 21/34 (61%), Positives = 25/34 (73%), Gaps = 5/34 (14%) Frame = +1 Query: 598 INCVALTARF-----PVGKPVVPAALMNRPTRGE 684 + C+A R+ P+GKPVVPAALMNRPTRGE Sbjct: 58 VRCIAEGGRYKKNVSPIGKPVVPAALMNRPTRGE 91 >SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 45.2 bits (102), Expect = 5e-05 Identities = 25/38 (65%), Positives = 27/38 (71%) Frame = +1 Query: 571 GCLMSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 G L E+ I+ V L PVGKPVVPAALMNRPTRGE Sbjct: 59 GKLHIEIKLIDTVDLEGG-PVGKPVVPAALMNRPTRGE 95 >SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 45.2 bits (102), Expect = 5e-05 Identities = 24/40 (60%), Positives = 28/40 (70%) Frame = +1 Query: 565 SLGCLMSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 S+ C + + I+ V L PVGKPVVPAALMNRPTRGE Sbjct: 36 SIDCETAIIKLIDTVDLEGG-PVGKPVVPAALMNRPTRGE 74 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 45.2 bits (102), Expect = 5e-05 Identities = 18/20 (90%), Positives = 20/20 (100%) Frame = +1 Query: 625 FPVGKPVVPAALMNRPTRGE 684 +P+GKPVVPAALMNRPTRGE Sbjct: 71 YPIGKPVVPAALMNRPTRGE 90 >SB_23874| Best HMM Match : SSIII (HMM E-Value=5.4) Length = 224 Score = 45.2 bits (102), Expect = 5e-05 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = +1 Query: 619 ARFPVGKPVVPAALMNRPTRGE 684 A F VGKPVVPAALMNRPTRGE Sbjct: 106 AEFSVGKPVVPAALMNRPTRGE 127 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 45.2 bits (102), Expect = 5e-05 Identities = 28/64 (43%), Positives = 34/64 (53%) Frame = +1 Query: 493 SCXXXXLLSAHNSTQHTSRKHKV*SLGCLMSELTHINCVALTARFPVGKPVVPAALMNRP 672 +C + +ST R S G ++ I+ V L PVGKPVVPAALMNRP Sbjct: 88 NCNTTHYRANRSSTSGGGRSRTSGSPGLQEFDIKLIDTVDLEGG-PVGKPVVPAALMNRP 146 Query: 673 TRGE 684 TRGE Sbjct: 147 TRGE 150 >SB_58947| Best HMM Match : Helicase_C (HMM E-Value=0.058) Length = 168 Score = 44.8 bits (101), Expect = 7e-05 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = +1 Query: 577 LMSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 L+S + I+ V L PVGKPVVPAALMNRPTRGE Sbjct: 97 LLSLIKLIDTVDLEGG-PVGKPVVPAALMNRPTRGE 131 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 44.8 bits (101), Expect = 7e-05 Identities = 23/35 (65%), Positives = 27/35 (77%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 +S++ I+ V L PVGKPVVPAALMNRPTRGE Sbjct: 71 VSDIKLIDTVDLEGG-PVGKPVVPAALMNRPTRGE 104 >SB_47984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 231 Score = 44.8 bits (101), Expect = 7e-05 Identities = 23/35 (65%), Positives = 27/35 (77%) Frame = +1 Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 +S++ I+ V L PVGKPVVPAALMNRPTRGE Sbjct: 111 ISQIKLIDTVDLEGG-PVGKPVVPAALMNRPTRGE 144 >SB_43222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 44.8 bits (101), Expect = 7e-05 Identities = 20/31 (64%), Positives = 22/31 (70%) Frame = +1 Query: 592 THINCVALTARFPVGKPVVPAALMNRPTRGE 684 T + C R +GKPVVPAALMNRPTRGE Sbjct: 90 TCLRCSRFHQRLKLGKPVVPAALMNRPTRGE 120 >SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) Length = 217 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 112 PVGKPVVPAALMNRPTRGE 130 >SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 37 PVGKPVVPAALMNRPTRGE 55 >SB_58459| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 134 PVGKPVVPAALMNRPTRGE 152 >SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) Length = 341 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 236 PVGKPVVPAALMNRPTRGE 254 >SB_58084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 56 PVGKPVVPAALMNRPTRGE 74 >SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 61 PVGKPVVPAALMNRPTRGE 79 >SB_55949| Best HMM Match : FLYWCH (HMM E-Value=0.16) Length = 187 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 132 PVGKPVVPAALMNRPTRGE 150 >SB_55180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 50 PVGKPVVPAALMNRPTRGE 68 >SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 146 PVGKPVVPAALMNRPTRGE 164 >SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) Length = 148 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 43 PVGKPVVPAALMNRPTRGE 61 >SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 33 PVGKPVVPAALMNRPTRGE 51 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 333 PVGKPVVPAALMNRPTRGE 351 >SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 88 PVGKPVVPAALMNRPTRGE 106 >SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 74 PVGKPVVPAALMNRPTRGE 92 >SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) Length = 491 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 307 PVGKPVVPAALMNRPTRGE 325 >SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 108 PVGKPVVPAALMNRPTRGE 126 >SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 34 PVGKPVVPAALMNRPTRGE 52 >SB_45733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 806 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 468 PVGKPVVPAALMNRPTRGE 486 >SB_45470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 28 PVGKPVVPAALMNRPTRGE 46 >SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 93 PVGKPVVPAALMNRPTRGE 111 >SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 53 PVGKPVVPAALMNRPTRGE 71 >SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) Length = 209 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 154 PVGKPVVPAALMNRPTRGE 172 >SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 53 PVGKPVVPAALMNRPTRGE 71 >SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) Length = 229 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 37 PVGKPVVPAALMNRPTRGE 55 >SB_39953| Best HMM Match : Ank (HMM E-Value=1.8e-19) Length = 216 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 161 PVGKPVVPAALMNRPTRGE 179 >SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 57 PVGKPVVPAALMNRPTRGE 75 >SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) Length = 184 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 79 PVGKPVVPAALMNRPTRGE 97 >SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) Length = 150 Score = 44.4 bits (100), Expect = 9e-05 Identities = 21/38 (55%), Positives = 24/38 (63%) Frame = +1 Query: 571 GCLMSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684 G LM ++ C+ GKPVVPAALMNRPTRGE Sbjct: 26 GVLMFVISFSGCLGALRENVFGKPVVPAALMNRPTRGE 63 >SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 17 PVGKPVVPAALMNRPTRGE 35 >SB_35652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 56 PVGKPVVPAALMNRPTRGE 74 >SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 39 PVGKPVVPAALMNRPTRGE 57 >SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) Length = 841 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 290 PVGKPVVPAALMNRPTRGE 308 >SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 334 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 37 PVGKPVVPAALMNRPTRGE 55 >SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 78 PVGKPVVPAALMNRPTRGE 96 >SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 24 PVGKPVVPAALMNRPTRGE 42 >SB_30841| Best HMM Match : HLH (HMM E-Value=1.5) Length = 189 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 134 PVGKPVVPAALMNRPTRGE 152 >SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 92 PVGKPVVPAALMNRPTRGE 110 >SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 33 PVGKPVVPAALMNRPTRGE 51 >SB_28553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 36 PVGKPVVPAALMNRPTRGE 54 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 232 PVGKPVVPAALMNRPTRGE 250 >SB_26370| Best HMM Match : Drf_FH1 (HMM E-Value=5.2) Length = 190 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 135 PVGKPVVPAALMNRPTRGE 153 >SB_26141| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 28 PVGKPVVPAALMNRPTRGE 46 >SB_25318| Best HMM Match : fn3 (HMM E-Value=2e-15) Length = 911 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 744 PVGKPVVPAALMNRPTRGE 762 >SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 92 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 37 PVGKPVVPAALMNRPTRGE 55 >SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 239 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 134 PVGKPVVPAALMNRPTRGE 152 >SB_23451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 95 PVGKPVVPAALMNRPTRGE 113 >SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 219 PVGKPVVPAALMNRPTRGE 237 >SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) Length = 150 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 45 PVGKPVVPAALMNRPTRGE 63 >SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 53 PVGKPVVPAALMNRPTRGE 71 >SB_20654| Best HMM Match : Helicase_C (HMM E-Value=2.3e-21) Length = 1728 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 1673 PVGKPVVPAALMNRPTRGE 1691 >SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) Length = 200 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 95 PVGKPVVPAALMNRPTRGE 113 >SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 63 PVGKPVVPAALMNRPTRGE 81 >SB_19176| Best HMM Match : YGGT (HMM E-Value=1.1) Length = 409 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 107 PVGKPVVPAALMNRPTRGE 125 >SB_18680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 93 PVGKPVVPAALMNRPTRGE 111 >SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 32 PVGKPVVPAALMNRPTRGE 50 >SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 41 PVGKPVVPAALMNRPTRGE 59 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 935 PVGKPVVPAALMNRPTRGE 953 >SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 82 PVGKPVVPAALMNRPTRGE 100 >SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) Length = 520 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 415 PVGKPVVPAALMNRPTRGE 433 >SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) Length = 202 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 97 PVGKPVVPAALMNRPTRGE 115 >SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 70 PVGKPVVPAALMNRPTRGE 88 >SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) Length = 190 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 85 PVGKPVVPAALMNRPTRGE 103 >SB_10646| Best HMM Match : GPW_gp25 (HMM E-Value=5.8) Length = 197 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 142 PVGKPVVPAALMNRPTRGE 160 >SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 111 PVGKPVVPAALMNRPTRGE 129 >SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 47 PVGKPVVPAALMNRPTRGE 65 >SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 40 PVGKPVVPAALMNRPTRGE 58 >SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 70 PVGKPVVPAALMNRPTRGE 88 >SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 61 PVGKPVVPAALMNRPTRGE 79 >SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 38 PVGKPVVPAALMNRPTRGE 56 >SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 31 PVGKPVVPAALMNRPTRGE 49 >SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) Length = 189 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 84 PVGKPVVPAALMNRPTRGE 102 >SB_3614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 62 PVGKPVVPAALMNRPTRGE 80 >SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 94 PVGKPVVPAALMNRPTRGE 112 >SB_1174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 49 PVGKPVVPAALMNRPTRGE 67 >SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) Length = 160 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 55 PVGKPVVPAALMNRPTRGE 73 >SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 33 PVGKPVVPAALMNRPTRGE 51 >SB_56924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 14 PVGKPVVPAALMNRPTRGE 32 >SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 35 PVGKPVVPAALMNRPTRGE 53 >SB_55232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 44 PVGKPVVPAALMNRPTRGE 62 >SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 141 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 37 PVGKPVVPAALMNRPTRGE 55 >SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3) Length = 180 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 75 PVGKPVVPAALMNRPTRGE 93 >SB_52605| Best HMM Match : UPF0004 (HMM E-Value=3.6) Length = 138 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 83 PVGKPVVPAALMNRPTRGE 101 >SB_52560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1263 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/26 (73%), Positives = 23/26 (88%) Frame = +1 Query: 607 VALTARFPVGKPVVPAALMNRPTRGE 684 +++ +F VGKPVVPAALMNRPTRGE Sbjct: 379 LSMKKKFLVGKPVVPAALMNRPTRGE 404 >SB_51037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 27 PVGKPVVPAALMNRPTRGE 45 >SB_49985| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 127 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 37 PVGKPVVPAALMNRPTRGE 55 >SB_49124| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 48 PVGKPVVPAALMNRPTRGE 66 >SB_48664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 92 PVGKPVVPAALMNRPTRGE 110 >SB_47765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 19 PVGKPVVPAALMNRPTRGE 37 >SB_47738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 32 PVGKPVVPAALMNRPTRGE 50 >SB_47238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 123 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 18 PVGKPVVPAALMNRPTRGE 36 >SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 71 PVGKPVVPAALMNRPTRGE 89 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 99 PVGKPVVPAALMNRPTRGE 117 >SB_45871| Best HMM Match : ABC_tran (HMM E-Value=2.5e-08) Length = 435 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 231 PVGKPVVPAALMNRPTRGE 249 >SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 100 PVGKPVVPAALMNRPTRGE 118 >SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 82 PVGKPVVPAALMNRPTRGE 100 >SB_45393| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.088) Length = 488 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 383 PVGKPVVPAALMNRPTRGE 401 >SB_44008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 53 PVGKPVVPAALMNRPTRGE 71 >SB_43854| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.7) Length = 177 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 72 PVGKPVVPAALMNRPTRGE 90 >SB_43776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 31 PVGKPVVPAALMNRPTRGE 49 >SB_43062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 32 PVGKPVVPAALMNRPTRGE 50 >SB_42773| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 100 PVGKPVVPAALMNRPTRGE 118 >SB_42727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 82 PVGKPVVPAALMNRPTRGE 100 >SB_40658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 86 PVGKPVVPAALMNRPTRGE 104 >SB_40501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 17 PVGKPVVPAALMNRPTRGE 35 >SB_40404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 28 PVGKPVVPAALMNRPTRGE 46 >SB_39352| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 77 PVGKPVVPAALMNRPTRGE 95 >SB_39336| Best HMM Match : Kinesin (HMM E-Value=0) Length = 558 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 453 PVGKPVVPAALMNRPTRGE 471 >SB_39081| Best HMM Match : Pertussis_S2S3 (HMM E-Value=9.8) Length = 178 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 73 PVGKPVVPAALMNRPTRGE 91 >SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 90 PVGKPVVPAALMNRPTRGE 108 >SB_38298| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 23 PVGKPVVPAALMNRPTRGE 41 >SB_37805| Best HMM Match : DoxA (HMM E-Value=1.7) Length = 788 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 733 PVGKPVVPAALMNRPTRGE 751 >SB_36672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 123 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 18 PVGKPVVPAALMNRPTRGE 36 >SB_36066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 32 PVGKPVVPAALMNRPTRGE 50 >SB_35778| Best HMM Match : Dickkopf_N (HMM E-Value=2.4) Length = 178 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 73 PVGKPVVPAALMNRPTRGE 91 >SB_35502| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 34 PVGKPVVPAALMNRPTRGE 52 >SB_35393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 44 PVGKPVVPAALMNRPTRGE 62 >SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) Length = 205 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 100 PVGKPVVPAALMNRPTRGE 118 >SB_34374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 306 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 201 PVGKPVVPAALMNRPTRGE 219 >SB_34337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 106 PVGKPVVPAALMNRPTRGE 124 >SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 142 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 37 PVGKPVVPAALMNRPTRGE 55 >SB_34031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 23 PVGKPVVPAALMNRPTRGE 41 >SB_33205| Best HMM Match : Mucin (HMM E-Value=0.0024) Length = 286 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 181 PVGKPVVPAALMNRPTRGE 199 >SB_32541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 34 PVGKPVVPAALMNRPTRGE 52 >SB_31524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 66 PVGKPVVPAALMNRPTRGE 84 >SB_31275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 36 PVGKPVVPAALMNRPTRGE 54 >SB_29812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 123 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 18 PVGKPVVPAALMNRPTRGE 36 >SB_29441| Best HMM Match : MFS_1 (HMM E-Value=1.6e-12) Length = 473 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 20 PVGKPVVPAALMNRPTRGE 38 >SB_29161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 51 PVGKPVVPAALMNRPTRGE 69 >SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) Length = 397 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 292 PVGKPVVPAALMNRPTRGE 310 >SB_27070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 19 PVGKPVVPAALMNRPTRGE 37 >SB_26894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 110 PVGKPVVPAALMNRPTRGE 128 >SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 51 PVGKPVVPAALMNRPTRGE 69 >SB_24394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 182 PVGKPVVPAALMNRPTRGE 200 >SB_22691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 37 PVGKPVVPAALMNRPTRGE 55 >SB_21601| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) Length = 370 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 265 PVGKPVVPAALMNRPTRGE 283 >SB_21132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 28 PVGKPVVPAALMNRPTRGE 46 >SB_20517| Best HMM Match : Nuclease_act (HMM E-Value=1.4) Length = 123 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 68 PVGKPVVPAALMNRPTRGE 86 >SB_20344| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 48 PVGKPVVPAALMNRPTRGE 66 >SB_20082| Best HMM Match : DUF378 (HMM E-Value=4.1) Length = 568 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 463 PVGKPVVPAALMNRPTRGE 481 >SB_18568| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.5e-22) Length = 636 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 60 PVGKPVVPAALMNRPTRGE 78 >SB_18544| Best HMM Match : 7tm_1 (HMM E-Value=0.00082) Length = 370 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 265 PVGKPVVPAALMNRPTRGE 283 >SB_16764| Best HMM Match : ACPS (HMM E-Value=4.4) Length = 136 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 31 PVGKPVVPAALMNRPTRGE 49 >SB_16421| Best HMM Match : HD-ZIP_N (HMM E-Value=7.6) Length = 213 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 108 PVGKPVVPAALMNRPTRGE 126 >SB_16384| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.1) Length = 171 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 66 PVGKPVVPAALMNRPTRGE 84 >SB_16112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 90 PVGKPVVPAALMNRPTRGE 108 >SB_15218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 70 PVGKPVVPAALMNRPTRGE 88 >SB_14808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 107 PVGKPVVPAALMNRPTRGE 125 >SB_11965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 19 PVGKPVVPAALMNRPTRGE 37 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 335 PVGKPVVPAALMNRPTRGE 353 >SB_11390| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 22 PVGKPVVPAALMNRPTRGE 40 >SB_11195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 596 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 541 PVGKPVVPAALMNRPTRGE 559 >SB_10723| Best HMM Match : Chromo (HMM E-Value=0.031) Length = 191 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 86 PVGKPVVPAALMNRPTRGE 104 >SB_10325| Best HMM Match : ubiquitin (HMM E-Value=3.4e-05) Length = 198 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 143 PVGKPVVPAALMNRPTRGE 161 >SB_9384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 468 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 363 PVGKPVVPAALMNRPTRGE 381 >SB_9135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 25 PVGKPVVPAALMNRPTRGE 43 >SB_8821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 26 PVGKPVVPAALMNRPTRGE 44 >SB_8316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 123 Score = 44.4 bits (100), Expect = 9e-05 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +1 Query: 607 VALTARFPVGKPVVPAALMNRPTRGE 684 VAL VGKPVVPAALMNRPTRGE Sbjct: 11 VALDGILAVGKPVVPAALMNRPTRGE 36 >SB_8089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 20 PVGKPVVPAALMNRPTRGE 38 >SB_6860| Best HMM Match : zf-C3HC4 (HMM E-Value=0.14) Length = 129 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 74 PVGKPVVPAALMNRPTRGE 92 >SB_6458| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 49 PVGKPVVPAALMNRPTRGE 67 >SB_6008| Best HMM Match : CPSase_L_D2 (HMM E-Value=0) Length = 866 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 811 PVGKPVVPAALMNRPTRGE 829 >SB_5051| Best HMM Match : DUF1193 (HMM E-Value=0.88) Length = 634 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 436 PVGKPVVPAALMNRPTRGE 454 >SB_4934| Best HMM Match : NAD_binding_2 (HMM E-Value=4.8) Length = 186 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 628 PVGKPVVPAALMNRPTRGE 684 PVGKPVVPAALMNRPTRGE Sbjct: 81 PVGKPVVPAALMNRPTRGE 99 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,792,340 Number of Sequences: 59808 Number of extensions: 446317 Number of successful extensions: 2100 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 1873 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2100 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1769412099 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -