BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0103 (685 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 26 0.96 U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 23 6.8 AJ697721-1|CAG26914.1| 135|Anopheles gambiae putative odorant-b... 23 9.0 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 26.2 bits (55), Expect = 0.96 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -3 Query: 314 PLVRASSELTVERRSYRIVPSRTKRNRHDLTARK 213 P ++ T RRS + P R +RN H LT + Sbjct: 1028 PTAGENAYSTTHRRSQTLSPVRNERNYHTLTTTR 1061 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 23.4 bits (48), Expect = 6.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 1 ALRTGACRVWTGSGCGRCRVWSM 69 ++ G V G+ C C VWSM Sbjct: 6 SVHVGQAGVQIGNPCWDCTVWSM 28 >AJ697721-1|CAG26914.1| 135|Anopheles gambiae putative odorant-binding protein OBPjj11 protein. Length = 135 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/31 (35%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +2 Query: 302 HGQGESDCLI-KTKHCDGPRGC*RNVISAQC 391 +GQ ++D L+ + ++ DGP C R+ QC Sbjct: 95 YGQEKADELVARCRNNDGPDACERSFRLLQC 125 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 718,604 Number of Sequences: 2352 Number of extensions: 14639 Number of successful extensions: 29 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68995575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -