BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0101 (509 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 3.4 AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 24 3.4 AY745229-1|AAU93509.1| 56|Anopheles gambiae glutaredoxin protein. 23 4.5 AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 23 4.5 AJ459960-1|CAD31059.1| 696|Anopheles gambiae prophenoloxidase 7... 23 6.0 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 23 6.0 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 23 7.9 DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 23 7.9 AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled ... 23 7.9 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.8 bits (49), Expect = 3.4 Identities = 16/50 (32%), Positives = 23/50 (46%) Frame = +2 Query: 74 PNASSSN**RA*MD*RDSHCPYLLSSETTAKGTGLGESAGKADPVELDSS 223 P AS S R + +SH P ++ T LG SAG E+D++ Sbjct: 2416 PVASLSEGFRKALQIYNSHVPDIVGVLNNHFMTALGRSAGDVQSYEIDAN 2465 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 23.8 bits (49), Expect = 3.4 Identities = 10/18 (55%), Positives = 14/18 (77%), Gaps = 1/18 (5%) Frame = -2 Query: 466 PPGSVLEP-DHAGVLNGD 416 PPGS+L+P D A V+ G+ Sbjct: 1092 PPGSILDPSDGAAVVGGN 1109 >AY745229-1|AAU93509.1| 56|Anopheles gambiae glutaredoxin protein. Length = 56 Score = 23.4 bits (48), Expect = 4.5 Identities = 11/24 (45%), Positives = 16/24 (66%), Gaps = 4/24 (16%) Frame = +3 Query: 441 SGSRTLP----GGEFDWGGTSVKE 500 +G+RT+P GG F GGT +K+ Sbjct: 21 TGARTVPRVFIGGNFVGGGTDIKK 44 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 23.4 bits (48), Expect = 4.5 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -2 Query: 487 VPPQSNSPPGSVLEPD 440 +PP SNS P S PD Sbjct: 868 MPPSSNSSPSSYPSPD 883 >AJ459960-1|CAD31059.1| 696|Anopheles gambiae prophenoloxidase 7 protein. Length = 696 Score = 23.0 bits (47), Expect = 6.0 Identities = 8/27 (29%), Positives = 15/27 (55%) Frame = -3 Query: 267 ISHLSTPLMSPYNARLESSSTGSAFPA 187 + +L TP+ PY ++ S+ +PA Sbjct: 273 LDNLRTPIPEPYYPKILRSANNRTYPA 299 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.0 bits (47), Expect = 6.0 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -3 Query: 87 DEAFGYLKRVIVTPAVYPRLLEFLHVD 7 D +F L RV TPA P +EFL ++ Sbjct: 635 DASFNRLTRV--TPATIPNSIEFLFLN 659 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 22.6 bits (46), Expect = 7.9 Identities = 7/24 (29%), Positives = 15/24 (62%) Frame = +3 Query: 93 ISDAHEWINEIPTVPIYYLAKPQP 164 +SD E ++ +P++P+ +P P Sbjct: 354 VSDRSESVSPVPSLPVRSSPEPSP 377 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 22.6 bits (46), Expect = 7.9 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +1 Query: 280 SSLENHYFHCFITYSVGRK 336 SS +FHC+ GRK Sbjct: 403 SSFFQQFFHCYCPVKFGRK 421 >AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled receptor 3 protein. Length = 605 Score = 22.6 bits (46), Expect = 7.9 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -1 Query: 446 TGSRGSFKRRRAFPPRHHSARL 381 TGS GS + AFP H SA + Sbjct: 124 TGSAGSSTQIAAFPLDHSSAAI 145 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 550,275 Number of Sequences: 2352 Number of extensions: 12658 Number of successful extensions: 32 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46091631 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -