BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0099 (684 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 25 0.67 AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 23 3.6 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 22 4.7 DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein ... 21 8.3 AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein ... 21 8.3 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 8.3 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 25.0 bits (52), Expect = 0.67 Identities = 15/49 (30%), Positives = 20/49 (40%) Frame = +3 Query: 450 GGEFDWGGTSVNE*RRCPKAAQRGQKPRVEQKGKSWLDPDVQYA*GLRK 596 GG+ DW + NE C PR + G + L + Y G RK Sbjct: 119 GGDLDWKYYTTNESHACLSTGGSCYWPRGKNLGGTTLHHGMAYHRGHRK 167 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = +1 Query: 460 LTGAVHLSTNNAGVLRQLSED 522 L G + T+ AGV+++L+ED Sbjct: 225 LFGDFNFRTDTAGVIKKLTED 245 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 22.2 bits (45), Expect = 4.7 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +1 Query: 268 SSLKNHYFHCFITYSVGRK 324 SS +FHC+ GRK Sbjct: 420 SSFFQQFFHCYCPVRFGRK 438 >DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein 1 protein. Length = 116 Score = 21.4 bits (43), Expect = 8.3 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +1 Query: 262 ARSSLKNHYFHCFI 303 A L+N Y+ CFI Sbjct: 37 ANDRLRNQYYDCFI 50 >AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein protein. Length = 116 Score = 21.4 bits (43), Expect = 8.3 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +1 Query: 262 ARSSLKNHYFHCFI 303 A L+N Y+ CFI Sbjct: 37 ANDRLRNQYYDCFI 50 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.4 bits (43), Expect = 8.3 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -1 Query: 243 ATPLMSPYNARLESSSTGSSFP 178 A + SP + SSTGSS P Sbjct: 347 AKQMASPEPPKSSESSTGSSIP 368 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 196,234 Number of Sequences: 438 Number of extensions: 4322 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20830365 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -