BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0088 (672 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL132847-1|CAB63371.1| 375|Caenorhabditis elegans Hypothetical ... 28 5.3 AF100656-7|AAF99964.2| 615|Caenorhabditis elegans Hypothetical ... 28 5.3 >AL132847-1|CAB63371.1| 375|Caenorhabditis elegans Hypothetical protein Y48G10A.2 protein. Length = 375 Score = 28.3 bits (60), Expect = 5.3 Identities = 10/31 (32%), Positives = 20/31 (64%) Frame = -1 Query: 171 KDMLTVEPRESGGSKQCDFTSRVSHSKREKR 79 K ++ EP+E+ + D+ + ++HSK EK+ Sbjct: 326 KMLIRTEPKETALRRAADYLNELTHSKTEKK 356 >AF100656-7|AAF99964.2| 615|Caenorhabditis elegans Hypothetical protein F49F1.8 protein. Length = 615 Score = 28.3 bits (60), Expect = 5.3 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = -2 Query: 326 CRCDSNTAQYERNRSFGHLVHALGERPVVRSYHPR 222 CR +S+ + + H VH + E P +S HP+ Sbjct: 404 CRVESSDSDSDSLNQDEHAVHTIEENPNTKSSHPK 438 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,481,737 Number of Sequences: 27780 Number of extensions: 316989 Number of successful extensions: 866 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 833 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 865 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1518563232 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -