BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0086 (739 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53001| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_30799| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_32812| Best HMM Match : CfAFP (HMM E-Value=9.5) 47 2e-05 SB_11908| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_42131| Best HMM Match : 7tm_1 (HMM E-Value=8.5e-35) 42 5e-04 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_26688| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_50942| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) 30 2.3 SB_50216| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_55897| Best HMM Match : RVT_1 (HMM E-Value=5.3e-37) 28 9.1 SB_45482| Best HMM Match : BTB (HMM E-Value=5.6e-11) 28 9.1 SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 SB_27207| Best HMM Match : eIF-5a (HMM E-Value=3.1e-15) 28 9.1 SB_6030| Best HMM Match : rve (HMM E-Value=8.7e-30) 28 9.1 SB_39271| Best HMM Match : Secretin_N (HMM E-Value=2.4) 28 9.1 SB_36990| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 SB_35785| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 SB_31551| Best HMM Match : RVT_1 (HMM E-Value=5.3e-37) 28 9.1 SB_27585| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 SB_18117| Best HMM Match : rve (HMM E-Value=1.7e-29) 28 9.1 SB_14634| Best HMM Match : ATP-synt_E (HMM E-Value=2.6) 28 9.1 SB_12900| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 SB_9508| Best HMM Match : Secretin_N (HMM E-Value=1.8) 28 9.1 >SB_53001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 52.8 bits (121), Expect = 3e-07 Identities = 22/27 (81%), Positives = 23/27 (85%) Frame = +2 Query: 389 MPRHLISDAHEWINEIPTVPIYYLAKP 469 MPRHLISDAHEWINEIPTVPI +P Sbjct: 1 MPRHLISDAHEWINEIPTVPIIEFLQP 27 >SB_30799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 52.0 bits (119), Expect = 5e-07 Identities = 32/68 (47%), Positives = 45/68 (66%), Gaps = 2/68 (2%) Frame = -3 Query: 647 LPPNRVSNETMKVVVFQRRSRETISHLCYTSHVSLQCQTRVKLNRV--SFPADSPKPVPL 474 LP +R+S +T++VVVF RR I+ Y++ + + R++ + SFPAD KPVPL Sbjct: 67 LPLHRISKKTIRVVVFHRR----IATPTYSTPLMSFHRVRLESSSTGSSFPADCAKPVPL 122 Query: 473 AVVSLDSR 450 AVVSLDSR Sbjct: 123 AVVSLDSR 130 >SB_32812| Best HMM Match : CfAFP (HMM E-Value=9.5) Length = 167 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = +3 Query: 306 SALNVNVKKFKQARVNGGSNYDSL 377 +ALNV VKKF QARVNGGSNYDSL Sbjct: 28 AALNVKVKKFNQARVNGGSNYDSL 51 >SB_11908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 309 ALNVNVKKFKQARVNGGSNYDSL 377 ALNV VKKF QARVNG SNYDSL Sbjct: 2 ALNVKVKKFNQARVNGWSNYDSL 24 >SB_42131| Best HMM Match : 7tm_1 (HMM E-Value=8.5e-35) Length = 521 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = -2 Query: 318 HSEHWAEITLRQHPRGPSQCFV 253 ++EHWAEITLRQH PSQCFV Sbjct: 48 NNEHWAEITLRQHRFRPSQCFV 69 >SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = +3 Query: 303 PSALNVNVKKFKQARVNGGSNYDS 374 PSALNV VKKF QARVNGG +S Sbjct: 31 PSALNVKVKKFNQARVNGGDPLES 54 >SB_26688| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1199 Score = 31.5 bits (68), Expect = 0.74 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = -2 Query: 210 LTVERRSYRIVPIAHETKPTRPYG*EDPRKA-GERGSGSSPKRKT 79 L+V R Y++VP++HE + R A +GSGSSP R T Sbjct: 1038 LSVSGRCYKVVPLSHELCLVSKSLWNNRRSADNPKGSGSSPTRDT 1082 >SB_50942| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 638 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = -3 Query: 719 PATSPLCTLGTKHRAPADIIDRAPLPPNRV 630 P P GT HR PA+ R +P NRV Sbjct: 510 PTNFPESVPGTHHRVPAEATGRVDVPDNRV 539 >SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) Length = 250 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = -3 Query: 719 PATSPLCTLGTKHRAPADIIDRAPLPPNRV 630 P P GT HR PA+ R +P NRV Sbjct: 216 PTNFPESVPGTHHRVPAEATGRVDVPDNRV 245 >SB_50216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3293 Score = 29.5 bits (63), Expect = 3.0 Identities = 27/96 (28%), Positives = 41/96 (42%) Frame = -3 Query: 719 PATSPLCTLGTKHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRETISHLCYTSHVSLQ 540 PA+S + G +H AP IID P +++ T KV V++ ++ T H S S Q Sbjct: 740 PASSRI--KGFEHNAPQPIIDEGP-DTSQLRPRTSKVAVWE-TAQATTQHSESVSETSPQ 795 Query: 539 CQTRVKLNRVSFPADSPKPVPLAVVSLDSR*GQWES 432 + + PA + SL +R W S Sbjct: 796 LSSTAQQTPPHSPATRHNARTSSPQSLATRHNAWTS 831 >SB_55897| Best HMM Match : RVT_1 (HMM E-Value=5.3e-37) Length = 732 Score = 27.9 bits (59), Expect = 9.1 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +2 Query: 566 ISGRSFRAIVAEKPLLSLFH 625 + GR F I KPLLSLFH Sbjct: 374 VFGRDFDIITDHKPLLSLFH 393 >SB_45482| Best HMM Match : BTB (HMM E-Value=5.6e-11) Length = 3037 Score = 27.9 bits (59), Expect = 9.1 Identities = 11/33 (33%), Positives = 21/33 (63%) Frame = -3 Query: 674 PADIIDRAPLPPNRVSNETMKVVVFQRRSRETI 576 PA + +++PLP N ++E +++ QRR E + Sbjct: 2409 PAKLPNQSPLPNNASASEIQRILENQRREEELL 2441 >SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1829 Score = 27.9 bits (59), Expect = 9.1 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +2 Query: 566 ISGRSFRAIVAEKPLLSLFH 625 + GR F I KPLLSLFH Sbjct: 1317 VFGRDFDIITDHKPLLSLFH 1336 >SB_27207| Best HMM Match : eIF-5a (HMM E-Value=3.1e-15) Length = 710 Score = 27.9 bits (59), Expect = 9.1 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +2 Query: 566 ISGRSFRAIVAEKPLLSLFH 625 + GR F I KPLLSLFH Sbjct: 79 VFGRDFDIITDHKPLLSLFH 98 >SB_6030| Best HMM Match : rve (HMM E-Value=8.7e-30) Length = 1280 Score = 27.9 bits (59), Expect = 9.1 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +2 Query: 566 ISGRSFRAIVAEKPLLSLFH 625 + GR F I KPLLSLFH Sbjct: 608 VFGRDFDIITDHKPLLSLFH 627 >SB_39271| Best HMM Match : Secretin_N (HMM E-Value=2.4) Length = 300 Score = 27.9 bits (59), Expect = 9.1 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +2 Query: 566 ISGRSFRAIVAEKPLLSLFH 625 + GR F I KPLLSLFH Sbjct: 259 VFGRDFDIITDHKPLLSLFH 278 >SB_36990| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 254 Score = 27.9 bits (59), Expect = 9.1 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = -1 Query: 187 QNRADRARNETDTTLRLGRSAEGRRTRVR 101 +NRA RA + L+ R EGRRTR R Sbjct: 52 ENRALRAHRKCGIILQAFRKFEGRRTRTR 80 >SB_35785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1089 Score = 27.9 bits (59), Expect = 9.1 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +2 Query: 566 ISGRSFRAIVAEKPLLSLFH 625 + GR F I KPLLSLFH Sbjct: 568 VFGRDFDIITDHKPLLSLFH 587 >SB_31551| Best HMM Match : RVT_1 (HMM E-Value=5.3e-37) Length = 429 Score = 27.9 bits (59), Expect = 9.1 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +2 Query: 566 ISGRSFRAIVAEKPLLSLFH 625 + GR F I KPLLSLFH Sbjct: 347 VFGRDFDIITDHKPLLSLFH 366 >SB_27585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 27.9 bits (59), Expect = 9.1 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +2 Query: 566 ISGRSFRAIVAEKPLLSLFH 625 + GR F I KPLLSLFH Sbjct: 167 VFGRDFDIITDHKPLLSLFH 186 >SB_18117| Best HMM Match : rve (HMM E-Value=1.7e-29) Length = 1544 Score = 27.9 bits (59), Expect = 9.1 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +2 Query: 566 ISGRSFRAIVAEKPLLSLFH 625 + GR F I KPLLSLFH Sbjct: 773 VFGRDFDIITDHKPLLSLFH 792 >SB_14634| Best HMM Match : ATP-synt_E (HMM E-Value=2.6) Length = 309 Score = 27.9 bits (59), Expect = 9.1 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +2 Query: 566 ISGRSFRAIVAEKPLLSLFH 625 + GR F I KPLLSLFH Sbjct: 167 VFGRDFDIITDHKPLLSLFH 186 >SB_12900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 27.9 bits (59), Expect = 9.1 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +2 Query: 566 ISGRSFRAIVAEKPLLSLFH 625 + GR F I KPLLSLFH Sbjct: 608 VFGRDFDIITDHKPLLSLFH 627 >SB_9508| Best HMM Match : Secretin_N (HMM E-Value=1.8) Length = 391 Score = 27.9 bits (59), Expect = 9.1 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +2 Query: 566 ISGRSFRAIVAEKPLLSLFH 625 + GR F I KPLLSLFH Sbjct: 241 VFGRDFDIITDHKPLLSLFH 260 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,541,883 Number of Sequences: 59808 Number of extensions: 507688 Number of successful extensions: 1195 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 1104 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1192 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1986074805 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -