BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0085 (691 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_06_0002 + 9382559-9382937,9383008-9383180,9386752-9386901,938... 30 2.0 03_03_0053 + 14109636-14109948,14110075-14110302,14112030-141121... 29 3.5 03_03_0090 + 14367033-14367279,14367402-14368205,14368314-143700... 28 6.1 04_01_0178 + 2006369-2006494,2006582-2006664,2007693-2007819,200... 28 8.0 >10_06_0002 + 9382559-9382937,9383008-9383180,9386752-9386901, 9387180-9387325,9387416-9387572,9387720-9387778, 9388204-9388360,9389001-9389150,9389280-9389416, 9390071-9390217,9390292-9390393,9390742-9390799, 9391997-9392034,9392124-9392250,9392320-9392493, 9393125-9393256,9393940-9394049,9394752-9394812, 9395036-9395213,9395326-9395531,9395796-9395915, 9396496-9396594,9396983-9397204,9397482-9397621, 9397741-9397852,9398021-9398071,9398151-9398240, 9398397-9398567,9398663-9398815,9399774-9399950, 9400045-9400182,9400295-9400365,9400739-9400838, 9401324-9401380,9401469-9401525,9401619-9401699, 9401782-9401864,9401975-9402110 Length = 1632 Score = 29.9 bits (64), Expect = 2.0 Identities = 17/65 (26%), Positives = 31/65 (47%) Frame = +3 Query: 300 CRPTSTLTEEHRDRILILNRRFLERRLTDDMLRKRVSITADACTDSAAHKCNYELFNRNN 479 C + + D+ L+L R+ + MLR +TA+A +++ K E ++NN Sbjct: 1045 CAAAKSAAQSEHDKNLLLQRQLDDSLREITMLRSSKIMTAEAERENSNLKNLVESLSKNN 1104 Query: 480 FSIRY 494 S+ Y Sbjct: 1105 SSLEY 1109 >03_03_0053 + 14109636-14109948,14110075-14110302,14112030-14112181, 14112305-14112578,14112687-14112739 Length = 339 Score = 29.1 bits (62), Expect = 3.5 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = +2 Query: 158 PVIPINHYLGVLKTNKIEPRSYSIIPCTKYSSTFLARFEHS 280 P+ + YLG+ NK+ P+ Y + C K+ + F H+ Sbjct: 248 PIGCVPGYLGIFP-NKLSPKDYDVFGCIKWLNDFSKYHNHA 287 >03_03_0090 + 14367033-14367279,14367402-14368205,14368314-14370039, 14370135-14370219,14370398-14370457,14370744-14370836 Length = 1004 Score = 28.3 bits (60), Expect = 6.1 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +2 Query: 170 INHYLGVLKTNKIEPRSYSIIPCTKYSSTFLARFE 274 I H L +LK KI P +I C +YS ++ F+ Sbjct: 819 ILHALHILKAEKIFPTESNIADCIRYSEMNISGFD 853 >04_01_0178 + 2006369-2006494,2006582-2006664,2007693-2007819, 2008579-2008638,2009606-2009735,2009821-2010047, 2010226-2010318,2010395-2010466,2011392-2011532, 2012045-2012047,2012387-2012443,2012909-2012995, 2013081-2013116 Length = 413 Score = 27.9 bits (59), Expect = 8.0 Identities = 19/59 (32%), Positives = 24/59 (40%) Frame = +2 Query: 146 IRMPPVIPINHYLGVLKTNKIEPRSYSIIPCTKYSSTFLARFEHSNLFKVKLSAHLDTH 322 I+M P P H+L N + P YSST F H+N F + L TH Sbjct: 53 IKMVPPGP--HFLYYCSPNSYGQNNLHEKPHIDYSSTICDPFRHANEFAPTVGFFLTTH 109 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,266,992 Number of Sequences: 37544 Number of extensions: 371337 Number of successful extensions: 857 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 834 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 857 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1756684372 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -