BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0085 (691 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF025453-12|AAK31405.1| 600|Caenorhabditis elegans Hypothetical... 29 3.1 Z81579-4|CAE17915.1| 212|Caenorhabditis elegans Hypothetical pr... 27 9.6 >AF025453-12|AAK31405.1| 600|Caenorhabditis elegans Hypothetical protein C08F1.8 protein. Length = 600 Score = 29.1 bits (62), Expect = 3.1 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 3/58 (5%) Frame = +1 Query: 460 SFLTATILV-YAIGAGITRLLAPDLPSNCSSLKY--LKCTHSDYEARKSPVSLFFVTT 624 SF+T T L+ YA+ + LL L CS + Y LK T + Y ++K +++FF T Sbjct: 451 SFVTITALMGYAV-CNLLVLLVEQLSETCSPMNYTLLKTTKATY-SQKMFMAIFFAIT 506 >Z81579-4|CAE17915.1| 212|Caenorhabditis elegans Hypothetical protein R13H4.8 protein. Length = 212 Score = 27.5 bits (58), Expect = 9.6 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -2 Query: 477 CCG*KARSCICAPRCRC 427 CCG C C PRC C Sbjct: 79 CCGCGCGCCCCRPRCCC 95 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,415,974 Number of Sequences: 27780 Number of extensions: 319408 Number of successful extensions: 793 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 755 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 787 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1581836700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -