BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0081 (629 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled ... 25 2.0 AJ459961-1|CAD31060.1| 700|Anopheles gambiae prophenoloxidase 8... 24 4.6 >AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled receptor 3 protein. Length = 605 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +3 Query: 243 LLQIHGQVPATHLSNVCLINF 305 LLQ+ GQ+PAT +NV + F Sbjct: 475 LLQVFGQIPATQ-TNVAIATF 494 >AJ459961-1|CAD31060.1| 700|Anopheles gambiae prophenoloxidase 8 protein. Length = 700 Score = 23.8 bits (49), Expect = 4.6 Identities = 25/93 (26%), Positives = 36/93 (38%), Gaps = 4/93 (4%) Frame = -1 Query: 605 FNRNNFSIRYWSWNYRGCWHQTCPPIVPR*NI*---VYSFRLRGLVRVPY-RYFSSLPPV 438 F R + + W++ + + PP V R + Y + L R RY L + Sbjct: 212 FFREDIGVNLHHWHWHLVYPASGPPDVVRKDRRGELFYYMHQQLLARYQIDRYAQGLGRI 271 Query: 437 PGVGNLRACCLPWMW*PFLRLPLRNRTLIPRYP 339 + NLR + LR NRT PRYP Sbjct: 272 EPLANLREPVREAYYPKLLRTS-NNRTFCPRYP 303 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 647,075 Number of Sequences: 2352 Number of extensions: 14595 Number of successful extensions: 67 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 67 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 67 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 61468785 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -