BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0079 (617 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g17550.1 68415.m02031 expressed protein 28 4.3 At1g67970.1 68414.m07764 heat shock factor protein, putative (HS... 28 5.7 At3g44800.1 68416.m04826 meprin and TRAF homology domain-contain... 27 7.5 At1g06460.1 68414.m00684 31.2 kDa small heat shock family protei... 27 7.5 At4g33830.1 68417.m04801 glycosyl hydrolase family 10 protein xy... 27 10.0 At2g29040.1 68415.m03530 exostosin family protein contains Pfam ... 27 10.0 At1g03900.1 68414.m00374 expressed protein 27 10.0 >At2g17550.1 68415.m02031 expressed protein Length = 765 Score = 28.3 bits (60), Expect = 4.3 Identities = 18/70 (25%), Positives = 31/70 (44%) Frame = +3 Query: 51 RSRDARVKKKTDSIDLRDPNGLRRRVSRFECETRLVKSHCLEPPDSRGSTVSISLPDSAR 230 R+ D + T + + D N LRR+++ E E ++ EP + V + PD Sbjct: 527 RNVDYLSQVSTPDVTVSDENELRRQINELESEVQVRTPVEEEPIQEIETIVDLGNPDKVF 586 Query: 231 LASALEAFGI 260 + L A G+ Sbjct: 587 VRDLLVASGL 596 >At1g67970.1 68414.m07764 heat shock factor protein, putative (HSF5) / heat shock transcription factor, putative (HSTF5) identical to heat shock transcription factor 5 (HSF5) SP:Q9S7U5 from [Arabidopsis thaliana]; contains Pfam profile: PF00447 HSF-type DNA-binding domain Length = 374 Score = 27.9 bits (59), Expect = 5.7 Identities = 12/44 (27%), Positives = 22/44 (50%) Frame = -2 Query: 292 GRWCEATIRGIMPNASKAEASLAESGKDMLTVEPRESGGSKQCD 161 G W + + +K + ++ + GKD LT+E E G+ + D Sbjct: 286 GAWEKLLLLSPSRKKTKKQENIVKKGKDDLTLEEEEEDGTMELD 329 >At3g44800.1 68416.m04826 meprin and TRAF homology domain-containing protein / MATH domain-containing protein Length = 564 Score = 27.5 bits (58), Expect = 7.5 Identities = 16/51 (31%), Positives = 27/51 (52%) Frame = +3 Query: 15 EPRHRTELYPDLRSRDARVKKKTDSIDLRDPNGLRRRVSRFECETRLVKSH 167 +PR R LY D + + + K+T S+D+ NG + S+ E R+ + H Sbjct: 149 KPRKRMRLYGDGGAVSSHLHKETSSVDV---NGFQVLPSQAESVKRIFERH 196 >At1g06460.1 68414.m00684 31.2 kDa small heat shock family protein / hsp20 family protein contains Pfam profile: PF00011 Hsp20/alpha crystallin family Length = 285 Score = 27.5 bits (58), Expect = 7.5 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = -3 Query: 243 RPKPA*PNPARICSLWSPESREALNNVTLLVAFRIQNAR-RDVEAHLD 103 RPK P A + ++WSP S A + + +VA + A D+ +D Sbjct: 169 RPKLDLPKLANLGTVWSPRSNVAESTHSYVVAIELPGASINDIRVEVD 216 >At4g33830.1 68417.m04801 glycosyl hydrolase family 10 protein xylan endohydrolase isoenzyme X-I, Hordeum vulgare,PID:g1813595 Length = 544 Score = 27.1 bits (57), Expect = 10.0 Identities = 23/72 (31%), Positives = 29/72 (40%) Frame = -1 Query: 305 HSAERPVVRSYHPRDYAERL*GRSQPSRIRQGYAHCGAPRVGRL*TM*LY*SRFAFKTRD 126 ++ E P P Y E+L Q R+R G G T + R A T Sbjct: 348 YTLEDPTDLKASPAKYLEKL-RELQSIRVR-GNIPLGIGLESHFSTPNIPYMRSALDTLG 405 Query: 125 ATSKPIWIAEID 90 AT PIW+ EID Sbjct: 406 ATGLPIWLTEID 417 >At2g29040.1 68415.m03530 exostosin family protein contains Pfam profile: PF03016 exostosin family Length = 720 Score = 27.1 bits (57), Expect = 10.0 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 2/48 (4%) Frame = -1 Query: 323 SDIWFMHSAERPVVRSYHPRDYAERL*GRSQPSRIRQGY--AHCGAPR 186 S W H P +HP YAE + + + RI + Y + GAPR Sbjct: 462 SSPWNYHGFAVPYPTYFHPSTYAEIIQWQMRMRRINRRYLFSFVGAPR 509 >At1g03900.1 68414.m00374 expressed protein Length = 272 Score = 27.1 bits (57), Expect = 10.0 Identities = 17/41 (41%), Positives = 25/41 (60%), Gaps = 2/41 (4%) Frame = -3 Query: 270 SAGLCRTPLRPKPA*PNPARICSLWSPESR--EALNNVTLL 154 +AG+ R+PL P P P +RI S ESR E L++++ L Sbjct: 207 AAGVTRSPLPPPPNDPVASRIASDGCKESRRNEPLSDLSQL 247 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,832,459 Number of Sequences: 28952 Number of extensions: 289422 Number of successful extensions: 739 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 732 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 739 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1246162608 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -