BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0076 (634 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z37139-5|CAA85490.1| 558|Caenorhabditis elegans Hypothetical pr... 29 3.7 U80453-9|AAT81206.1| 432|Caenorhabditis elegans Hypothetical pr... 28 4.8 AF078788-1|AAC26965.2| 629|Caenorhabditis elegans Hypothetical ... 28 4.8 U97006-1|AAC47965.1| 2076|Caenorhabditis elegans Hypothetical pr... 27 8.4 >Z37139-5|CAA85490.1| 558|Caenorhabditis elegans Hypothetical protein C14B1.9 protein. Length = 558 Score = 28.7 bits (61), Expect = 3.7 Identities = 20/98 (20%), Positives = 43/98 (43%), Gaps = 2/98 (2%) Frame = -2 Query: 606 PREVSVLAELALGHLRYSLTDVPPQSNSPHGSVSNRI-TREF*TATSVSATSPLCTLGTK 430 P+++S+ ++G + ++P Q NSP +V N T + A S + ++ K Sbjct: 252 PKKISLDKPKSVGSPSNAHNEIPSQKNSPKSAVKNETDTEDALMAKSGNLSTAAVMFKNK 311 Query: 429 -HRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRETIS 319 H +D P N ET+ ++ + ++ ++ Sbjct: 312 VHTLQCQFLDSHGNPQNTPDFETLSKILSEHFDKKELT 349 >U80453-9|AAT81206.1| 432|Caenorhabditis elegans Hypothetical protein C23H3.9d protein. Length = 432 Score = 28.3 bits (60), Expect = 4.8 Identities = 20/62 (32%), Positives = 28/62 (45%), Gaps = 1/62 (1%) Frame = -2 Query: 549 TDVPPQSNSPHGSVSNRITREF*TATSVSATSPLCTLGTKHRAPADIIDRAPLPP-NRVS 373 T P+S+S + R+ + T T +A S T +AP I DR P NR+S Sbjct: 69 TTSEPRSHSRDARPTQRLPLTWSTVTPTAAPSQPIPTATSRKAPWYIKDRTAWPTYNRIS 128 Query: 372 NE 367 E Sbjct: 129 AE 130 >AF078788-1|AAC26965.2| 629|Caenorhabditis elegans Hypothetical protein ZC190.4 protein. Length = 629 Score = 28.3 bits (60), Expect = 4.8 Identities = 13/45 (28%), Positives = 28/45 (62%) Frame = -2 Query: 441 LGTKHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRETISHLCY 307 +GT+ + DIID +P N +S++ + +++ R ET++H+ + Sbjct: 287 VGTR-KTSTDIIDGFNVPSNMISDDNLPALIY--RVIETLNHMIF 328 >U97006-1|AAC47965.1| 2076|Caenorhabditis elegans Hypothetical protein C13F10.4 protein. Length = 2076 Score = 27.5 bits (58), Expect = 8.4 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +3 Query: 501 GSRHCHAGSLTGAVHLSKNNAGVLRPAQRGQKPRVE 608 G H H GSL HL+ + VL A+ + P+V+ Sbjct: 937 GCLHRHVGSLGSGQHLNTGVSVVLALAEESKMPKVQ 972 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,223,350 Number of Sequences: 27780 Number of extensions: 284291 Number of successful extensions: 695 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 679 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 695 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1395683256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -