BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0071 (637 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1271.15c |||translation initiation factor IF-2Mt|Schizosacch... 27 1.7 SPBC4C3.05c |nuc1|rpa1|DNA-directed RNA polymerase I complex lar... 26 5.2 SPAC926.09c |fas1||fatty acid synthase beta subunit Fas1|Schizos... 25 9.1 SPAPB1A10.13 |||sequence orphan|Schizosaccharomyces pombe|chr 1|... 25 9.1 >SPBC1271.15c |||translation initiation factor IF-2Mt|Schizosaccharomyces pombe|chr 2|||Manual Length = 686 Score = 27.5 bits (58), Expect = 1.7 Identities = 16/58 (27%), Positives = 30/58 (51%) Frame = +2 Query: 452 LHSLIGNETPRECEITNVADNFILPERTSSVRLHFRYAFQFNVKNL*NS*LAHMLDSL 625 L++ +G T + E +D I+ S + FR A + NVK L ++ + H++D + Sbjct: 515 LYTGVGPVTETDIERAETSDAIIISFGVSVPKATFRLAEKHNVKLLFHNVIYHLMDDV 572 >SPBC4C3.05c |nuc1|rpa1|DNA-directed RNA polymerase I complex large subunit Nuc1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1689 Score = 25.8 bits (54), Expect = 5.2 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = -2 Query: 249 YKILKQSHPVKRMIRGIGAETTSTYSQ 169 YK L Q + VK ++ + +ET S+Y++ Sbjct: 1086 YKSLIQKYKVKSVLSAVDSETASSYAK 1112 >SPAC926.09c |fas1||fatty acid synthase beta subunit Fas1|Schizosaccharomyces pombe|chr 1|||Manual Length = 2073 Score = 25.0 bits (52), Expect = 9.1 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -1 Query: 166 FKWVRTPAYSNDEAGDL 116 F ++ P YS D+AGDL Sbjct: 443 FSALKVPVYSTDDAGDL 459 >SPAPB1A10.13 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 529 Score = 25.0 bits (52), Expect = 9.1 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +3 Query: 339 SICTSESLRSSIRVSPDFDLTRHSSPSFGSQHLCS 443 S TS S ++SI S + + HSSPSF + L S Sbjct: 460 SPATSPSNQASIHASFTKESSTHSSPSFTLESLFS 494 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,672,667 Number of Sequences: 5004 Number of extensions: 55687 Number of successful extensions: 125 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 122 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 125 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 283719918 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -