BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0071 (637 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19053| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_13467| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_32500| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_24543| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_20448| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_5288| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_4968| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_3995| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_1350| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_59236| Best HMM Match : Attractin (HMM E-Value=8.2) 45 6e-05 SB_53668| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_53194| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_47973| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_40285| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_16426| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_15603| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_19187| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_7775| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_161| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_11440| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_40592| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.036 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_36629| Best HMM Match : Fer2 (HMM E-Value=0.0041) 31 0.78 SB_6844| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) 30 1.4 SB_55151| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 29 4.2 SB_47253| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_40022| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_28768| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_17596| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_15711| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_13940| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_3184| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_57385| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_54119| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_52963| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_50350| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_49656| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_34064| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_31920| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_28366| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8) 29 4.2 SB_25308| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_24745| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_2618| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_46879| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_41433| Best HMM Match : Neur_chan_LBD (HMM E-Value=4.6e-07) 27 9.7 >SB_19053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 50.8 bits (116), Expect = 9e-07 Identities = 25/42 (59%), Positives = 29/42 (69%) Frame = +2 Query: 44 LNTTFGSSHSASSAYQNWPTWHRHQISGFIVRVSRSSHPFKV 169 LN FGSS ASSAYQ WPT + H +SGF SR+S+ FKV Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGFNY-ASRTSYQFKV 57 >SB_13467| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 38 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = +1 Query: 355 NRYGPPSGFPLTST*PGIVHHLSGPSICA 441 NRY PP FPL S GIVHHLSGP+ CA Sbjct: 1 NRYEPPPEFPLASPYSGIVHHLSGPNRCA 29 >SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 44.8 bits (101), Expect = 6e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 44 LNTTFGSSHSASSAYQNWPTWHRHQISGF 130 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 57 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 85 >SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 44.8 bits (101), Expect = 6e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 44 LNTTFGSSHSASSAYQNWPTWHRHQISGF 130 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 54 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 82 >SB_32500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.8 bits (101), Expect = 6e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 44 LNTTFGSSHSASSAYQNWPTWHRHQISGF 130 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_24543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.8 bits (101), Expect = 6e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 44 LNTTFGSSHSASSAYQNWPTWHRHQISGF 130 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_20448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 44.8 bits (101), Expect = 6e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 44 LNTTFGSSHSASSAYQNWPTWHRHQISGF 130 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 55 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 83 >SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 44.8 bits (101), Expect = 6e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 44 LNTTFGSSHSASSAYQNWPTWHRHQISGF 130 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 55 LNRAFGSSRIASSAYQKWPTSNSHSLSGF 83 >SB_5288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 44.8 bits (101), Expect = 6e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 44 LNTTFGSSHSASSAYQNWPTWHRHQISGF 130 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_4968| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.8 bits (101), Expect = 6e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 44 LNTTFGSSHSASSAYQNWPTWHRHQISGF 130 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_3995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.8 bits (101), Expect = 6e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 44 LNTTFGSSHSASSAYQNWPTWHRHQISGF 130 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTKNSHSLSGF 45 >SB_1350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 44.8 bits (101), Expect = 6e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 44 LNTTFGSSHSASSAYQNWPTWHRHQISGF 130 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_59236| Best HMM Match : Attractin (HMM E-Value=8.2) Length = 125 Score = 44.8 bits (101), Expect = 6e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 44 LNTTFGSSHSASSAYQNWPTWHRHQISGF 130 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 96 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 124 >SB_53668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.8 bits (101), Expect = 6e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 44 LNTTFGSSHSASSAYQNWPTWHRHQISGF 130 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_53194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.8 bits (101), Expect = 6e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 44 LNTTFGSSHSASSAYQNWPTWHRHQISGF 130 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_47973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.8 bits (101), Expect = 6e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 44 LNTTFGSSHSASSAYQNWPTWHRHQISGF 130 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_40285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.8 bits (101), Expect = 6e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 44 LNTTFGSSHSASSAYQNWPTWHRHQISGF 130 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_16426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.8 bits (101), Expect = 6e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 44 LNTTFGSSHSASSAYQNWPTWHRHQISGF 130 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_15603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 44.8 bits (101), Expect = 6e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 44 LNTTFGSSHSASSAYQNWPTWHRHQISGF 130 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 139 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 167 >SB_19187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.4 bits (100), Expect = 8e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 44 LNTTFGSSHSASSAYQNWPTWHRHQISGF 130 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNHAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_7775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 44.0 bits (99), Expect = 1e-04 Identities = 33/88 (37%), Positives = 44/88 (50%), Gaps = 1/88 (1%) Frame = +3 Query: 354 ESLRSSIRVSPDFDLTRHSSPSFGSQHLCSERAFIH*LETRRLGSAKSRT-XXXXXXXXX 530 ESLR+S RVS F L RHSSPSFGSQ + R++ + L R+G + R Sbjct: 35 ESLRASTRVSSGFTLFRHSSPSFGSQQM---RSYSN-LSKSRIGRSMMRLFFVEKGSHLS 90 Query: 531 ERRAFAFTFVTPFSLMLKIYKTHDSHTC 614 +R F + + F + DSHTC Sbjct: 91 DRSRLHFHYASEFRSL------KDSHTC 112 >SB_161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 43.6 bits (98), Expect = 1e-04 Identities = 18/29 (62%), Positives = 21/29 (72%) Frame = +2 Query: 44 LNTTFGSSHSASSAYQNWPTWHRHQISGF 130 LN +GSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAYGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_11440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 41.5 bits (93), Expect = 6e-04 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 44 LNTTFGSSHSASSAYQNWPTWHRHQISGF 130 LN FGSS ASSA Q WPT + H +SGF Sbjct: 74 LNRAFGSSRIASSALQKWPTRNSHSLSGF 102 >SB_40592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 44 LNTTFGSSHSASSAYQNWPTWHRHQISGF 130 LN FGSS ASSAYQ PT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKGPTRNSHSLSGF 45 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 38.3 bits (85), Expect = 0.005 Identities = 16/26 (61%), Positives = 18/26 (69%) Frame = +2 Query: 44 LNTTFGSSHSASSAYQNWPTWHRHQI 121 LN FGSS ASSAYQ WPT + H + Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSL 42 >SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.5 bits (78), Expect = 0.036 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = +2 Query: 44 LNTTFGSSHSASSAYQNWPT 103 LN FGSS ASSAYQ WPT Sbjct: 17 LNRAFGSSRIASSAYQKWPT 36 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 33.1 bits (72), Expect = 0.19 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +1 Query: 355 NRYGPPSGFPLTST*PGIVHH 417 NRY PP FPL S GIVHH Sbjct: 1 NRYEPPPEFPLASPYSGIVHH 21 >SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 32.7 bits (71), Expect = 0.26 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 305 ISLSPLYPVPTIDLHVR 355 ISLSPLYP TIDLHVR Sbjct: 38 ISLSPLYPNLTIDLHVR 54 >SB_36629| Best HMM Match : Fer2 (HMM E-Value=0.0041) Length = 128 Score = 31.1 bits (67), Expect = 0.78 Identities = 18/68 (26%), Positives = 37/68 (54%), Gaps = 4/68 (5%) Frame = -1 Query: 529 LREDEIISYVRDFALPRRLVSNQ*MKARSEHKC----WDPKDGELCLVRSKSGETLMEDR 362 L + + S L RR VSN + +++H+ + +DG+ V++K G++L++ Sbjct: 15 LSQQRLASRASASILARRYVSNGKEQTKAKHETVSITFVDRDGDRQTVKAKVGDSLLDVA 74 Query: 361 SDSDVQID 338 D+DV ++ Sbjct: 75 KDNDVDLE 82 >SB_6844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 30.7 bits (66), Expect = 1.0 Identities = 14/19 (73%), Positives = 14/19 (73%) Frame = +2 Query: 44 LNTTFGSSHSASSAYQNWP 100 LN FGSS ASSAYQN P Sbjct: 17 LNRAFGSSRIASSAYQNGP 35 Score = 28.3 bits (60), Expect = 5.5 Identities = 18/43 (41%), Positives = 20/43 (46%) Frame = +3 Query: 3 PTPFMVSHERFLGALTLRLVHPTAPVLLTKIGPLGTVIRSPAS 131 PTPF+ S ER L L + GPLGT I PAS Sbjct: 3 PTPFVGSDERRLWHLNRAFGSSRIASSAYQNGPLGTRIHCPAS 45 >SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) Length = 276 Score = 30.3 bits (65), Expect = 1.4 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = +2 Query: 56 FGSSHSASSAYQNWPTWHRHQISGF 130 FGSS ASS YQN PT R GF Sbjct: 78 FGSSRIASSGYQNGPTRTRIHCPGF 102 Score = 29.9 bits (64), Expect = 1.8 Identities = 26/66 (39%), Positives = 33/66 (50%), Gaps = 7/66 (10%) Frame = +3 Query: 3 PTPFMVSHERFLGALTLRLVHPTAPVLLTKI-------GPLGTVIRSPASSFE*AGVLTH 161 PTPF+ S ER RL HP ++I GP T I P + + G+LT+ Sbjct: 60 PTPFVGSDER-------RLWHPYRAFGSSRIASSGYQNGPTRTRIHCPGFNKQ-VGLLTN 111 Query: 162 LKFENR 179 LKFENR Sbjct: 112 LKFENR 117 >SB_55151| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 402 Score = 28.7 bits (61), Expect = 4.2 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +1 Query: 601 TRTHARLLGPCY 636 TRTH RLLGPC+ Sbjct: 261 TRTHVRLLGPCF 272 >SB_47253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 28.7 bits (61), Expect = 4.2 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +1 Query: 601 TRTHARLLGPCY 636 TRTH RLLGPC+ Sbjct: 31 TRTHVRLLGPCF 42 >SB_40022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 28.7 bits (61), Expect = 4.2 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +1 Query: 601 TRTHARLLGPCY 636 TRTH RLLGPC+ Sbjct: 31 TRTHVRLLGPCF 42 >SB_28768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 28.7 bits (61), Expect = 4.2 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +1 Query: 601 TRTHARLLGPCY 636 TRTH RLLGPC+ Sbjct: 31 TRTHVRLLGPCF 42 >SB_17596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 28.7 bits (61), Expect = 4.2 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +1 Query: 601 TRTHARLLGPCY 636 TRTH RLLGPC+ Sbjct: 31 TRTHVRLLGPCF 42 >SB_15711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 28.7 bits (61), Expect = 4.2 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +1 Query: 601 TRTHARLLGPCY 636 TRTH RLLGPC+ Sbjct: 31 TRTHVRLLGPCF 42 >SB_13940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 28.7 bits (61), Expect = 4.2 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +1 Query: 601 TRTHARLLGPCY 636 TRTH RLLGPC+ Sbjct: 31 TRTHVRLLGPCF 42 >SB_3184| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 28.7 bits (61), Expect = 4.2 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +1 Query: 601 TRTHARLLGPCY 636 TRTH RLLGPC+ Sbjct: 31 TRTHVRLLGPCF 42 >SB_57385| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 28.7 bits (61), Expect = 4.2 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +1 Query: 601 TRTHARLLGPCY 636 TRTH RLLGPC+ Sbjct: 31 TRTHVRLLGPCF 42 >SB_54119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 28.7 bits (61), Expect = 4.2 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +1 Query: 601 TRTHARLLGPCY 636 TRTH RLLGPC+ Sbjct: 31 TRTHVRLLGPCF 42 >SB_52963| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 28.7 bits (61), Expect = 4.2 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +1 Query: 601 TRTHARLLGPCY 636 TRTH RLLGPC+ Sbjct: 31 TRTHVRLLGPCF 42 >SB_50350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 28.7 bits (61), Expect = 4.2 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +1 Query: 601 TRTHARLLGPCY 636 TRTH RLLGPC+ Sbjct: 31 TRTHVRLLGPCF 42 >SB_49656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 292 Score = 28.7 bits (61), Expect = 4.2 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +1 Query: 601 TRTHARLLGPCY 636 TRTH RLLGPC+ Sbjct: 155 TRTHVRLLGPCF 166 >SB_34064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 425 Score = 28.7 bits (61), Expect = 4.2 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +1 Query: 601 TRTHARLLGPCY 636 TRTH RLLGPC+ Sbjct: 355 TRTHVRLLGPCF 366 >SB_31920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 28.7 bits (61), Expect = 4.2 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +1 Query: 601 TRTHARLLGPCY 636 TRTH RLLGPC+ Sbjct: 31 TRTHVRLLGPCF 42 >SB_28366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 28.7 bits (61), Expect = 4.2 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +1 Query: 601 TRTHARLLGPCY 636 TRTH RLLGPC+ Sbjct: 31 TRTHVRLLGPCF 42 >SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8) Length = 411 Score = 28.7 bits (61), Expect = 4.2 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +1 Query: 601 TRTHARLLGPCY 636 TRTH RLLGPC+ Sbjct: 274 TRTHVRLLGPCF 285 >SB_25308| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 28.7 bits (61), Expect = 4.2 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +1 Query: 601 TRTHARLLGPCY 636 TRTH RLLGPC+ Sbjct: 31 TRTHVRLLGPCF 42 >SB_24745| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 28.7 bits (61), Expect = 4.2 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +1 Query: 601 TRTHARLLGPCY 636 TRTH RLLGPC+ Sbjct: 31 TRTHVRLLGPCF 42 >SB_2618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 28.7 bits (61), Expect = 4.2 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +1 Query: 601 TRTHARLLGPCY 636 TRTH RLLGPC+ Sbjct: 31 TRTHVRLLGPCF 42 >SB_46879| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 27.5 bits (58), Expect = 9.7 Identities = 16/68 (23%), Positives = 32/68 (47%), Gaps = 1/68 (1%) Frame = -1 Query: 586 IFNIKLKGVTKVKANARRSLREDEIISYVRDFALPRRL-VSNQ*MKARSEHKCWDPKDGE 410 +F L G R L++D + F PR +S++ + + +++CW GE Sbjct: 172 LFGSHLLGERLFSMTGRNVLQQDGSTDFNCTFCKPRIYDISSEALTSVPKYRCWKYIGGE 231 Query: 409 LCLVRSKS 386 + +R+K+ Sbjct: 232 IAELRAKA 239 >SB_41433| Best HMM Match : Neur_chan_LBD (HMM E-Value=4.6e-07) Length = 175 Score = 27.5 bits (58), Expect = 9.7 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +3 Query: 33 FLGALTLRLVHPTAPVLLTKIGPLGTV 113 FL A T ++ H T P +T I P+G V Sbjct: 144 FLNAKTAKMHHVTTPNQMTLIAPMGVV 170 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,117,674 Number of Sequences: 59808 Number of extensions: 427074 Number of successful extensions: 985 Number of sequences better than 10.0: 53 Number of HSP's better than 10.0 without gapping: 869 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 985 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1596754500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -