BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0067 (605 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha ... 29 0.15 AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. 27 0.36 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 27 0.62 DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. 26 1.1 DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. 26 1.1 DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. 26 1.1 DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. 26 1.1 DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. 26 1.1 DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. 26 1.1 DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. 26 1.1 DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. 26 1.1 DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. 26 1.1 DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. 26 1.1 DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. 26 1.1 DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. 26 1.1 DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. 26 1.1 AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. 26 1.1 AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled ... 25 2.5 AJ697726-1|CAG26919.1| 198|Anopheles gambiae putative odorant-b... 24 3.3 >AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha 1 chain precursor protein. Length = 801 Score = 28.7 bits (61), Expect = 0.15 Identities = 21/58 (36%), Positives = 25/58 (43%), Gaps = 7/58 (12%) Frame = +1 Query: 322 LPWLSRVTGNQG-----SIPEREPEKRLP--HPRKAAGAQITHSRHGSFSGLPGPLGQ 474 LP LS + GN G IP + EK P HP Q + GLPGP G+ Sbjct: 188 LPGLSGLPGNPGPRGYAGIPGTKGEKGEPARHPENYNKGQKGEPGNDGLEGLPGPQGE 245 >AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. Length = 458 Score = 27.5 bits (58), Expect = 0.36 Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +1 Query: 349 NQGSIPEREPEKRLPHPRKAAGAQITHS-RHGSFSGLP 459 N GS PE P + + +K + + HS GS SGLP Sbjct: 103 NNGSFPELPPMRGKTYSKKLSFEYLQHSVTSGSGSGLP 140 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 26.6 bits (56), Expect = 0.62 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +1 Query: 478 EHADSFSVARGGPGHLRASQTCYCSISCGSKTPVPLR 588 EH++SFS G P A + Y + S+T P+R Sbjct: 1013 EHSNSFSYNYGSPAFPTAGENAYSTTHRRSQTLSPVR 1049 >DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 25.8 bits (54), Expect = 1.1 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -2 Query: 286 HLKDASPVLDQRSAK 242 HLKDASP L +R+ K Sbjct: 465 HLKDASPFLQERAVK 479 >DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 25.8 bits (54), Expect = 1.1 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -2 Query: 286 HLKDASPVLDQRSAK 242 HLKDASP L +R+ K Sbjct: 465 HLKDASPFLQERAVK 479 >DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 25.8 bits (54), Expect = 1.1 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -2 Query: 286 HLKDASPVLDQRSAK 242 HLKDASP L +R+ K Sbjct: 465 HLKDASPFLQERAVK 479 >DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 25.8 bits (54), Expect = 1.1 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -2 Query: 286 HLKDASPVLDQRSAK 242 HLKDASP L +R+ K Sbjct: 465 HLKDASPFLQERAVK 479 >DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 25.8 bits (54), Expect = 1.1 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -2 Query: 286 HLKDASPVLDQRSAK 242 HLKDASP L +R+ K Sbjct: 465 HLKDASPFLQERAVK 479 >DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 25.8 bits (54), Expect = 1.1 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -2 Query: 286 HLKDASPVLDQRSAK 242 HLKDASP L +R+ K Sbjct: 465 HLKDASPFLQERAVK 479 >DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 25.8 bits (54), Expect = 1.1 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -2 Query: 286 HLKDASPVLDQRSAK 242 HLKDASP L +R+ K Sbjct: 465 HLKDASPFLQERAVK 479 >DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 25.8 bits (54), Expect = 1.1 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -2 Query: 286 HLKDASPVLDQRSAK 242 HLKDASP L +R+ K Sbjct: 465 HLKDASPFLQERAVK 479 >DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 25.8 bits (54), Expect = 1.1 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -2 Query: 286 HLKDASPVLDQRSAK 242 HLKDASP L +R+ K Sbjct: 465 HLKDASPFLQERAVK 479 >DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 25.8 bits (54), Expect = 1.1 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -2 Query: 286 HLKDASPVLDQRSAK 242 HLKDASP L +R+ K Sbjct: 465 HLKDASPFLQERAVK 479 >DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 25.8 bits (54), Expect = 1.1 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -2 Query: 286 HLKDASPVLDQRSAK 242 HLKDASP L +R+ K Sbjct: 465 HLKDASPFLQERAVK 479 >DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 25.8 bits (54), Expect = 1.1 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -2 Query: 286 HLKDASPVLDQRSAK 242 HLKDASP L +R+ K Sbjct: 465 HLKDASPFLQERAVK 479 >DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 25.8 bits (54), Expect = 1.1 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -2 Query: 286 HLKDASPVLDQRSAK 242 HLKDASP L +R+ K Sbjct: 465 HLKDASPFLQERAVK 479 >AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. Length = 485 Score = 25.8 bits (54), Expect = 1.1 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -2 Query: 286 HLKDASPVLDQRSAK 242 HLKDASP L +R+ K Sbjct: 449 HLKDASPFLQERAVK 463 >AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled receptor 3 protein. Length = 605 Score = 24.6 bits (51), Expect = 2.5 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 241 LLQIAGQVPATHLSNVCLINF 303 LLQ+ GQ+PAT +NV + F Sbjct: 475 LLQVFGQIPATQ-TNVAIATF 494 >AJ697726-1|CAG26919.1| 198|Anopheles gambiae putative odorant-binding protein OBPjj16 protein. Length = 198 Score = 24.2 bits (50), Expect = 3.3 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = -3 Query: 456 QPAETPVPGVGNLRACCL 403 +P + P PGV CC+ Sbjct: 58 KPGQMPAPGVPRTEGCCI 75 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 642,486 Number of Sequences: 2352 Number of extensions: 14642 Number of successful extensions: 75 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 74 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 75 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58870980 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -