BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0055 (465 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC26H8.03 |cho2||phosphatidylethanolamine N-methyltransferase ... 27 1.4 SPBC3D6.03c |||tRNA endonuclease |Schizosaccharomyces pombe|chr ... 26 3.3 SPBC3E7.06c |||membrane transporter|Schizosaccharomyces pombe|ch... 25 5.7 SPAC4D7.01c |sec71|sec7a, SPAP8A3.15c|Sec7 domain|Schizosaccharo... 25 5.7 SPAC12G12.16c ||SPAC18B11.01c|nuclease, XP-G family|Schizosaccha... 25 7.5 SPCC736.14 |dis1||microtubule-associated protein Dis1 |Schizosac... 24 9.9 >SPBC26H8.03 |cho2||phosphatidylethanolamine N-methyltransferase Cho2|Schizosaccharomyces pombe|chr 2|||Manual Length = 905 Score = 27.1 bits (57), Expect = 1.4 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 125 LEFHSQLPMRHFLQLALWLSYC 60 LEF+S L RHF+ L L +C Sbjct: 199 LEFNSWLVFRHFVDLILMCDFC 220 >SPBC3D6.03c |||tRNA endonuclease |Schizosaccharomyces pombe|chr 2|||Manual Length = 678 Score = 25.8 bits (54), Expect = 3.3 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +2 Query: 167 SNAEVFSYVHEINPKFILGPLLSFSLDS 250 +N + S V +NP ++ PLL SLD+ Sbjct: 44 TNRIMLSVVSSLNPDSLIAPLLCVSLDN 71 >SPBC3E7.06c |||membrane transporter|Schizosaccharomyces pombe|chr 2|||Manual Length = 577 Score = 25.0 bits (52), Expect = 5.7 Identities = 6/19 (31%), Positives = 13/19 (68%) Frame = -3 Query: 106 FQCVTSYNWLFGFPIVFEN 50 F V ++ W++G P+ F++ Sbjct: 360 FHSVANFGWIYGMPLFFQS 378 >SPAC4D7.01c |sec71|sec7a, SPAP8A3.15c|Sec7 domain|Schizosaccharomyces pombe|chr 1|||Manual Length = 1811 Score = 25.0 bits (52), Expect = 5.7 Identities = 10/27 (37%), Positives = 20/27 (74%), Gaps = 1/27 (3%) Frame = +2 Query: 137 VFPSISDL-QLSNAEVFSYVHEINPKF 214 V+ +++D+ QL+++ + SYVH NP + Sbjct: 582 VYHTLNDIPQLNSSTIGSYVHSHNPPY 608 >SPAC12G12.16c ||SPAC18B11.01c|nuclease, XP-G family|Schizosaccharomyces pombe|chr 1|||Manual Length = 496 Score = 24.6 bits (51), Expect = 7.5 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = +2 Query: 167 SNAEVFSYVHEINPKFILGPLLSFSLDSENKV 262 SN E+FS++H I PK L S LD E +V Sbjct: 433 SNNELFSFIHNI-PKEFLHLSDSTYLDLEKQV 463 >SPCC736.14 |dis1||microtubule-associated protein Dis1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 882 Score = 24.2 bits (50), Expect = 9.9 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +2 Query: 137 VFPSISDLQLSNAEVFSYVHE 199 +F I+DLQ+ NAE+ V+E Sbjct: 718 LFREINDLQIQNAEMKEQVYE 738 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,646,528 Number of Sequences: 5004 Number of extensions: 28486 Number of successful extensions: 53 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 53 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 53 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 176367270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -