BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0038 (703 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC31H12.03c |||transcriptional regulator|Schizosaccharomyces p... 33 0.030 SPBC336.03 |efc25||exchange factor Cdc25p-like|Schizosaccharomyc... 29 0.64 SPAC926.09c |fas1||fatty acid synthase beta subunit Fas1|Schizos... 27 2.6 SPBC4C3.05c |nuc1|rpa1|DNA-directed RNA polymerase I complex lar... 27 2.6 SPBPB2B2.05 |||GMP synthase [glutamine-hydrolyzing] |Schizosacch... 25 7.9 SPAC4D7.08c |ade4|min13, aza1|amidophosphoribosyltransferase |Sc... 25 7.9 >SPCC31H12.03c |||transcriptional regulator|Schizosaccharomyces pombe|chr 3|||Manual Length = 245 Score = 33.5 bits (73), Expect = 0.030 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = +1 Query: 28 TRNPSPRQSSRASLEYLLLPPRSAPTEAPSGLTPRPFCALR-RARPTRYGLMIPN 189 ++NP R +SR+ PP+SAP++ S + P A + R R R+G+ N Sbjct: 191 SKNPQNRSNSRSKQRNKNAPPKSAPSKRKSNILDDPIEAEKARKRAERFGVAAKN 245 >SPBC336.03 |efc25||exchange factor Cdc25p-like|Schizosaccharomyces pombe|chr 2|||Manual Length = 987 Score = 29.1 bits (62), Expect = 0.64 Identities = 24/74 (32%), Positives = 32/74 (43%) Frame = +3 Query: 465 PASSFE*AGVLTHLNLRIG*GRFGPNASNHSLYRMRLF*NFISTPAILRETSDGTSY*MV 644 P+S FE H +L + GP +NHS + + T + LR S V Sbjct: 138 PSSPFEDMQASVH-SLPLSGCSIGPVRTNHSSSLSNSSNSLLQTESSLRPNSS-----FV 191 Query: 645 RLVFRPIPSSDDRF 686 F P+PSSDD F Sbjct: 192 NSPFFPLPSSDDLF 205 >SPAC926.09c |fas1||fatty acid synthase beta subunit Fas1|Schizosaccharomyces pombe|chr 1|||Manual Length = 2073 Score = 27.1 bits (57), Expect = 2.6 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -1 Query: 514 LKFKWVRTPAYSNDEAGDL 458 L+F ++ P YS D+AGDL Sbjct: 441 LQFSALKVPVYSTDDAGDL 459 >SPBC4C3.05c |nuc1|rpa1|DNA-directed RNA polymerase I complex large subunit Nuc1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1689 Score = 27.1 bits (57), Expect = 2.6 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = -3 Query: 602 SWRRYKILKQSHPVKRMIRGIGAETTSTYSQ 510 S + YK L Q + VK ++ + +ET S+Y++ Sbjct: 1082 SAKNYKSLIQKYKVKSVLSAVDSETASSYAK 1112 >SPBPB2B2.05 |||GMP synthase [glutamine-hydrolyzing] |Schizosaccharomyces pombe|chr 2|||Manual Length = 237 Score = 25.4 bits (53), Expect = 7.9 Identities = 8/21 (38%), Positives = 16/21 (76%) Frame = +2 Query: 230 RQNASAPSISGLVASAGESLH 292 ++N+ P+I G++ + GES+H Sbjct: 22 QRNSIPPNIDGIILAGGESVH 42 >SPAC4D7.08c |ade4|min13, aza1|amidophosphoribosyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 533 Score = 25.4 bits (53), Expect = 7.9 Identities = 14/47 (29%), Positives = 18/47 (38%) Frame = +3 Query: 225 CIGKTLQRHPFQGWLLRQVSRCTLLSGFRLPWPPSCCHERPTPFMVS 365 C G + F LRQ+ + R P SC H PF V+ Sbjct: 49 CKGSGMVADVFSQHQLRQLVGSMGIGHLRYPTAGSCAHSEAQPFYVN 95 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,028,757 Number of Sequences: 5004 Number of extensions: 63557 Number of successful extensions: 170 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 166 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 170 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 325165428 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -