BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0021 (673 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC128392-1|AAI28393.1| 782|Homo sapiens zinc finger protein 786... 31 2.8 BC109245-1|AAI09246.1| 753|Homo sapiens ZNF786 protein protein. 31 2.8 >BC128392-1|AAI28393.1| 782|Homo sapiens zinc finger protein 786 protein. Length = 782 Score = 31.5 bits (68), Expect = 2.8 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = +3 Query: 240 RAWENSGERRPC*A*XXSGIVRRHERCSISGRSFR 344 RAWE +R S V+RH RC + G+SFR Sbjct: 216 RAWEKFNKRAETQMPWSSPRVQRHFRCGVCGKSFR 250 >BC109245-1|AAI09246.1| 753|Homo sapiens ZNF786 protein protein. Length = 753 Score = 31.5 bits (68), Expect = 2.8 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = +3 Query: 240 RAWENSGERRPC*A*XXSGIVRRHERCSISGRSFR 344 RAWE +R S V+RH RC + G+SFR Sbjct: 187 RAWEKFNKRAETQMPWSSPRVQRHFRCGVCGKSFR 221 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 107,082,892 Number of Sequences: 237096 Number of extensions: 2459791 Number of successful extensions: 5792 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5494 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5792 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7647512560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -