BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0012 (399 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q05FX4 Cluster: Putative uncharacterized protein; n=1; ... 33 1.6 UniRef50_A0BDA5 Cluster: Chromosome undetermined scaffold_10, wh... 33 1.6 >UniRef50_Q05FX4 Cluster: Putative uncharacterized protein; n=1; Candidatus Carsonella ruddii PV|Rep: Putative uncharacterized protein - Carsonella ruddii (strain PV) Length = 45 Score = 33.5 bits (73), Expect = 1.6 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = +1 Query: 268 LKFYNNFIKKEIYIIYIVNKFYFIINYF 351 L F NF+ K+I+ +I KF+FIINYF Sbjct: 7 LNFVRNFLIKKIFF-FINKKFFFIINYF 33 >UniRef50_A0BDA5 Cluster: Chromosome undetermined scaffold_10, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_10, whole genome shotgun sequence - Paramecium tetraurelia Length = 475 Score = 33.5 bits (73), Expect = 1.6 Identities = 18/42 (42%), Positives = 25/42 (59%) Frame = +2 Query: 86 LIISYCSINILNN*FEMKCYSFLNISSFYRKKFNFLLIRFSY 211 LI+SYC++ L N F Y + I SFY +F FL IR ++ Sbjct: 296 LILSYCAV--LFNEFNQSEYLYRKIISFYYPQFRFLQIRQNF 335 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,441,100 Number of Sequences: 1657284 Number of extensions: 1841494 Number of successful extensions: 4877 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4706 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4874 length of database: 575,637,011 effective HSP length: 92 effective length of database: 423,166,883 effective search space used: 16926675320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -