BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0012 (399 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81054-12|CAB61006.1| 1781|Caenorhabditis elegans Hypothetical p... 27 5.0 Z81032-6|CAB60991.1| 1781|Caenorhabditis elegans Hypothetical pr... 27 5.0 AF038576-1|AAC38973.1| 1781|Caenorhabditis elegans CED-5 protein. 27 5.0 >Z81054-12|CAB61006.1| 1781|Caenorhabditis elegans Hypothetical protein C02F4.1 protein. Length = 1781 Score = 27.1 bits (57), Expect = 5.0 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = +1 Query: 253 RIIFKLKFYNNFIKKEIYIIYIVNKFYFIINYFSNR 360 R + +++YN + KE+Y+ YI K Y + + N+ Sbjct: 1210 RTVQLMRYYNQYSHKELYVKYIY-KLYDLHTSYGNK 1244 >Z81032-6|CAB60991.1| 1781|Caenorhabditis elegans Hypothetical protein C02F4.1 protein. Length = 1781 Score = 27.1 bits (57), Expect = 5.0 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = +1 Query: 253 RIIFKLKFYNNFIKKEIYIIYIVNKFYFIINYFSNR 360 R + +++YN + KE+Y+ YI K Y + + N+ Sbjct: 1210 RTVQLMRYYNQYSHKELYVKYIY-KLYDLHTSYGNK 1244 >AF038576-1|AAC38973.1| 1781|Caenorhabditis elegans CED-5 protein. Length = 1781 Score = 27.1 bits (57), Expect = 5.0 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = +1 Query: 253 RIIFKLKFYNNFIKKEIYIIYIVNKFYFIINYFSNR 360 R + +++YN + KE+Y+ YI K Y + + N+ Sbjct: 1210 RTVQLMRYYNQYSHKELYVKYIY-KLYDLHTSYGNK 1244 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,175,316 Number of Sequences: 27780 Number of extensions: 44225 Number of successful extensions: 102 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 102 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 102 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 619699724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -