BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0002 (720 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_05_0005 - 16886553-16886946,16887079-16887404 31 0.92 05_05_0322 + 24094831-24094992,24095147-24095216,24096184-240963... 29 3.7 >01_05_0005 - 16886553-16886946,16887079-16887404 Length = 239 Score = 31.1 bits (67), Expect = 0.92 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 3/47 (6%) Frame = -1 Query: 306 RYVRKRVSITA---DAVHRQPAHKCNYELFNRNNFSIRYWSWNYRGC 175 ++VR ++TA D P +C R+N S RYW W GC Sbjct: 61 KWVRDAAAVTAYREDCPFLDPGFQCISN--GRSNSSFRYWRWQPHGC 105 >05_05_0322 + 24094831-24094992,24095147-24095216,24096184-24096307, 24096403-24096502,24096598-24096825,24096916-24097041, 24097092-24097376,24097490-24097648,24097751-24097929, 24098078-24098210 Length = 521 Score = 29.1 bits (62), Expect = 3.7 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -2 Query: 326 LERRLTDDMSANVSVSPRMR 267 LERR TD MS+ V V+P+MR Sbjct: 283 LERRPTDYMSSQVEVNPKMR 302 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,018,203 Number of Sequences: 37544 Number of extensions: 380649 Number of successful extensions: 834 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 823 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 834 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1874582652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -