BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20933 (537 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_04_0333 + 20333243-20333329,20335048-20335110,20335276-203353... 95 3e-20 05_03_0407 + 13582595-13582681,13583067-13583129,13583289-135833... 95 4e-20 03_02_0544 - 9362615-9362674,9362783-9362857,9362934-9363144,936... 93 2e-19 07_01_1091 - 10015180-10015236,10015705-10015779,10015874-100161... 90 1e-18 03_01_0506 + 3816676-3817971 28 5.4 02_05_0748 - 31463559-31464764 28 5.4 11_06_0321 - 22341267-22342565 27 9.5 04_03_0612 + 18023354-18023916,18024046-18024805 27 9.5 03_02_0811 + 11437654-11438958 27 9.5 02_02_0682 - 12923103-12923747,12924607-12924870,12924953-129252... 27 9.5 >05_04_0333 + 20333243-20333329,20335048-20335110,20335276-20335359, 20335720-20335827,20335969-20336141,20337135-20337246, 20337468-20337548,20337635-20337697,20337779-20337880, 20338070-20338194,20338317-20338527,20338625-20338699, 20338990-20339043 Length = 445 Score = 95.1 bits (226), Expect = 3e-20 Identities = 44/84 (52%), Positives = 57/84 (67%) Frame = +2 Query: 2 FIAMVSTTVETNDPESEIRPGLALLGAIRQKFVSVTDYYEPIDDGSQSQIFISESYDATT 181 FIA VST ET+ PESE++PG+ LLG + + F + D YEP+++ S F+S SYDATT Sbjct: 350 FIAFVSTEAETDHPESELKPGIDLLGQVDELFFDIYDRYEPVNEPSLDNCFVSTSYDATT 409 Query: 182 HFETTCLDVLKIYKHGTGEEFDFS 253 HFETT DVL +Y TG+ D S Sbjct: 410 HFETTVTDVLNMYTLITGKTVDLS 433 >05_03_0407 + 13582595-13582681,13583067-13583129,13583289-13583372, 13583757-13583864,13584018-13584190,13585190-13585301, 13585424-13585504,13585611-13585673,13585764-13585865, 13586063-13586187,13586316-13586526,13586614-13586688, 13586950-13587003 Length = 445 Score = 94.7 bits (225), Expect = 4e-20 Identities = 43/84 (51%), Positives = 58/84 (69%) Frame = +2 Query: 2 FIAMVSTTVETNDPESEIRPGLALLGAIRQKFVSVTDYYEPIDDGSQSQIFISESYDATT 181 FIA VST ET++P+SE++PG+ LLG + + F + D YEP+++ S F+S SYDATT Sbjct: 350 FIAFVSTEAETDNPQSELKPGIDLLGQVDELFFDIYDRYEPVNEPSLDNCFVSTSYDATT 409 Query: 182 HFETTCLDVLKIYKHGTGEEFDFS 253 HFETT DVL +Y TG+ D S Sbjct: 410 HFETTVTDVLNMYTLITGKAVDLS 433 >03_02_0544 - 9362615-9362674,9362783-9362857,9362934-9363144, 9363279-9363403,9363492-9363593,9363676-9363738, 9363817-9363897,9364248-9364359,9364454-9364626, 9364722-9364829,9364909-9364992,9365131-9365193, 9365652-9365738 Length = 447 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/84 (48%), Positives = 54/84 (64%) Frame = +2 Query: 2 FIAMVSTTVETNDPESEIRPGLALLGAIRQKFVSVTDYYEPIDDGSQSQIFISESYDATT 181 FIA VST E + PE E++PG+ LLG + + F + D YEP + + F++ SYDATT Sbjct: 350 FIAFVSTEAEADKPEIELKPGIDLLGPVEETFFDIYDRYEPTNTADEDNCFVTNSYDATT 409 Query: 182 HFETTCLDVLKIYKHGTGEEFDFS 253 HFETT DVL +Y TG+E D S Sbjct: 410 HFETTVKDVLALYSKITGKELDLS 433 >07_01_1091 - 10015180-10015236,10015705-10015779,10015874-10016149, 10016204-10016332,10017070-10017171,10017626-10017688, 10017776-10017856,10018218-10018314,10019064-10019236, 10019327-10019434,10019706-10019789,10019985-10020047, 10020483-10020569 Length = 464 Score = 89.8 bits (213), Expect = 1e-18 Identities = 41/84 (48%), Positives = 55/84 (65%) Frame = +2 Query: 2 FIAMVSTTVETNDPESEIRPGLALLGAIRQKFVSVTDYYEPIDDGSQSQIFISESYDATT 181 FIA VS E+ +P +E++PG+ LLG + + F+ D +EP +D S FIS SYDATT Sbjct: 368 FIAFVSAQAESENPAAELKPGIDLLGPVDELFIDTYDRFEPTNDPSSDNCFISTSYDATT 427 Query: 182 HFETTCLDVLKIYKHGTGEEFDFS 253 HFE+T +DVL IY TG+ D S Sbjct: 428 HFESTVMDVLSIYTKITGKTVDLS 451 >03_01_0506 + 3816676-3817971 Length = 431 Score = 27.9 bits (59), Expect = 5.4 Identities = 9/24 (37%), Positives = 17/24 (70%) Frame = +2 Query: 233 GEEFDFSKSSWNLVKRISK*LRGL 304 GEE+D + SW +++ +S+ L G+ Sbjct: 299 GEEYDLKRRSWRVIENMSEGLNGV 322 >02_05_0748 - 31463559-31464764 Length = 401 Score = 27.9 bits (59), Expect = 5.4 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = +2 Query: 233 GEEFDFSKSSWNLVKRISK*LRG 301 GEE+D K +W +++ +S+ L G Sbjct: 269 GEEYDLEKGTWRVIENMSEGLNG 291 >11_06_0321 - 22341267-22342565 Length = 432 Score = 27.1 bits (57), Expect = 9.5 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +2 Query: 233 GEEFDFSKSSWNLVKRISK*LRG 301 GEEFD K +W L+ ++ L G Sbjct: 300 GEEFDLEKGTWRLIPDMASGLNG 322 >04_03_0612 + 18023354-18023916,18024046-18024805 Length = 440 Score = 27.1 bits (57), Expect = 9.5 Identities = 11/25 (44%), Positives = 19/25 (76%) Frame = +3 Query: 189 KQLVWMCLKFINMVLGKNLISLSQA 263 K L +CL+++N V+ K++I LSQ+ Sbjct: 223 KALERLCLEYVNGVIDKDMIVLSQS 247 >03_02_0811 + 11437654-11438958 Length = 434 Score = 27.1 bits (57), Expect = 9.5 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -1 Query: 111 SVTDTNFCLMAPKRAKP 61 + TD FCL AP RAKP Sbjct: 343 NTTDPYFCLSAPLRAKP 359 >02_02_0682 - 12923103-12923747,12924607-12924870,12924953-12925219, 12925301-12925529,12925614-12926295,12926409-12926682, 12926822-12927347,12927460-12927698,12927799-12927896, 12928017-12928020,12928657-12928832,12929593-12929647, 12930787-12931047 Length = 1239 Score = 27.1 bits (57), Expect = 9.5 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = -1 Query: 99 TNFCLMAPKRAKPGLISDSGSLVSTVV 19 TN CL P L+ +SGS STVV Sbjct: 1015 TNLCLRIPSGKTVALVGESGSGKSTVV 1041 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,612,740 Number of Sequences: 37544 Number of extensions: 220446 Number of successful extensions: 394 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 392 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 394 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1186491600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -