BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20933 (537 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value L10433-1|AAA27732.1| 149|Apis mellifera transposase protein. 22 3.5 L10430-1|AAA27731.1| 150|Apis mellifera transposase protein. 22 3.5 AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase pr... 22 3.5 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 21 6.0 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 21 8.0 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 21 8.0 >L10433-1|AAA27732.1| 149|Apis mellifera transposase protein. Length = 149 Score = 22.2 bits (45), Expect = 3.5 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -2 Query: 206 HPDKLFQSVWWHHK 165 H K+ SVWW +K Sbjct: 62 HRKKVLLSVWWDYK 75 >L10430-1|AAA27731.1| 150|Apis mellifera transposase protein. Length = 150 Score = 22.2 bits (45), Expect = 3.5 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = -2 Query: 206 HPDKLFQSVWWHHK 165 H K+ VWW HK Sbjct: 63 HRKKVLLLVWWDHK 76 >AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase protein. Length = 342 Score = 22.2 bits (45), Expect = 3.5 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -2 Query: 206 HPDKLFQSVWWHHK 165 H K+ SVWW +K Sbjct: 184 HRKKVLLSVWWDYK 197 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 21.4 bits (43), Expect = 6.0 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = +2 Query: 80 AIRQKFVSVTDYYEPIDDG 136 A +F ++ YY P++DG Sbjct: 783 ATASEFDEMSFYYSPVEDG 801 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.0 bits (42), Expect = 8.0 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = +2 Query: 146 QIFISESYDATTHFETTCLDVLKIYKHGTGEE 241 QIFI+ + A L +L I+ + GE+ Sbjct: 129 QIFIAPNNGAVKVLANEFLSILPIFLYALGEQ 160 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.0 bits (42), Expect = 8.0 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = +2 Query: 146 QIFISESYDATTHFETTCLDVLKIYKHGTGEE 241 QIFI+ + A L +L I+ + GE+ Sbjct: 167 QIFIAPNNGAVKVLANEFLSILPIFLYALGEQ 198 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 141,336 Number of Sequences: 438 Number of extensions: 2923 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15213684 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -