BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20929 (675 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC83.10 |||conserved eukaryotic protein|Schizosaccharomyces po... 27 2.5 SPCC1450.15 |||pig-F |Schizosaccharomyces pombe|chr 3|||Manual 26 5.7 >SPBC83.10 |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 189 Score = 27.1 bits (57), Expect = 2.5 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = -1 Query: 312 SFRLPNFNSTKYFSTLVSNNNKIDNFYVALKTASVFPKY 196 SF PN YF L S + + F++ + + V+P Y Sbjct: 66 SFTFPNVPDEIYFLRLESIDYEFSEFHIIINESIVYPYY 104 >SPCC1450.15 |||pig-F |Schizosaccharomyces pombe|chr 3|||Manual Length = 503 Score = 25.8 bits (54), Expect = 5.7 Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = -3 Query: 631 LQSFHLYYYWQVLQSLFTIY-MNITIYLNT 545 L FHL Y+ + S+FT+Y + T+ NT Sbjct: 404 LHDFHLTYFCALTLSVFTVYPLASTLAFNT 433 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,197,228 Number of Sequences: 5004 Number of extensions: 37656 Number of successful extensions: 71 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 71 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 71 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 309878492 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -