BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20914 (433 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization prot... 27 0.068 DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 23 1.5 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 23 1.5 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 23 1.5 U66709-1|AAB07515.1| 182|Apis mellifera ankyrin protein. 21 7.8 >DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization protein protein. Length = 250 Score = 27.5 bits (58), Expect = 0.068 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = +1 Query: 88 QPVSRTYQYRKVMKPMLERKRRARINRCLDELKELM 195 +P ++ Q + LE+ RRA + CL++LK L+ Sbjct: 40 RPKTKKSQGSRTTHNELEKNRRAHLRNCLEKLKVLV 75 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 23.0 bits (47), Expect = 1.5 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +2 Query: 341 WIYSRRQRSFPLSGFNSW 394 WI S S PL+G+N W Sbjct: 161 WILSGAISSPPLAGWNDW 178 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 23.0 bits (47), Expect = 1.5 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +2 Query: 341 WIYSRRQRSFPLSGFNSW 394 WI S S PL+G+N W Sbjct: 161 WILSGAISSPPLAGWNDW 178 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 23.0 bits (47), Expect = 1.5 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +2 Query: 341 WIYSRRQRSFPLSGFNSW 394 WI S S PL+G+N W Sbjct: 161 WILSGAISSPPLAGWNDW 178 >U66709-1|AAB07515.1| 182|Apis mellifera ankyrin protein. Length = 182 Score = 20.6 bits (41), Expect = 7.8 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = -2 Query: 165 VDASAPLALKHRFHHFAILISARDWL 88 V S PL + F +SAR WL Sbjct: 95 VTGSTPLTFVNDTVSFTTTVSARFWL 120 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,645 Number of Sequences: 438 Number of extensions: 2066 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 11244597 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -