BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20914 (433 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g25310.1 68414.m03141 basic helix-loop-helix (bHLH) family pr... 29 1.8 At5g20280.1 68418.m02414 sucrose-phosphate synthase, putative si... 28 2.4 At3g56770.1 68416.m06314 basic helix-loop-helix (bHLH) family pr... 28 3.1 At4g28800.1 68417.m04118 bHLH family protein contains Pfam profi... 27 7.2 At1g64385.1 68414.m07297 expressed protein 27 7.2 At3g47750.1 68416.m05202 ABC transporter family protein probable... 26 9.6 At1g23380.2 68414.m02924 homeobox transcription factor (KNAT6) n... 26 9.6 At1g23380.1 68414.m02925 homeobox transcription factor (KNAT6) n... 26 9.6 At1g16480.1 68414.m01971 pentatricopeptide (PPR) repeat-containi... 26 9.6 >At1g25310.1 68414.m03141 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 145 Score = 28.7 bits (61), Expect = 1.8 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = +1 Query: 133 MLERKRRARINRCLDELKELMVSALQSE 216 +L++KRR RI R L+ LKE+ + QS+ Sbjct: 73 LLKKKRRERIRRQLETLKEITPNCPQSD 100 >At5g20280.1 68418.m02414 sucrose-phosphate synthase, putative similar to sucrose-phosphate synthase (EC 2.4.1.14) isoform 1 - Citrus unshiu, EMBL:AB005023 Length = 1043 Score = 28.3 bits (60), Expect = 2.4 Identities = 15/55 (27%), Positives = 25/55 (45%) Frame = +1 Query: 4 SQTYALTHDTHTFNMSYEIAYSVAEDGPQPVSRTYQYRKVMKPMLERKRRARINR 168 + TY + +S +++ V Q + ++ P+LERK RARI R Sbjct: 361 NSTYKIMRRIEGEELSLDVSEMVITSTRQEIDEQWRLYDGFDPILERKLRARIKR 415 >At3g56770.1 68416.m06314 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 230 Score = 27.9 bits (59), Expect = 3.1 Identities = 12/19 (63%), Positives = 17/19 (89%) Frame = +1 Query: 139 ERKRRARINRCLDELKELM 195 ERKRRARIN L++L++L+ Sbjct: 53 ERKRRARINSHLNKLRKLL 71 >At4g28800.1 68417.m04118 bHLH family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 478 Score = 26.6 bits (56), Expect = 7.2 Identities = 15/54 (27%), Positives = 27/54 (50%) Frame = +1 Query: 76 EDGPQPVSRTYQYRKVMKPMLERKRRARINRCLDELKELMVSALQSEGENVAKL 237 E+ SR M + ER+RR +IN + L++L+ + E ++V+ L Sbjct: 243 EEARGSTSRKRSRTAEMHNLAERRRREKINEKMKTLQQLIPRCNKVESDSVSTL 296 >At1g64385.1 68414.m07297 expressed protein Length = 351 Score = 26.6 bits (56), Expect = 7.2 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +1 Query: 166 RCLDELKELMVSALQSEGENVAKLEKADILN 258 RC ELK+L +A ++E ++ + + ILN Sbjct: 207 RCRLELKDLAAAAHETESDDTVSVSRPSILN 237 >At3g47750.1 68416.m05202 ABC transporter family protein probable transport protein ABC-C, Homo sapiens, PIR2:S71363 Length = 944 Score = 26.2 bits (55), Expect = 9.6 Identities = 18/46 (39%), Positives = 21/46 (45%), Gaps = 6/46 (13%) Frame = -1 Query: 178 RRGSG*CERASCAQASVSSLCDIDKCA------RLAADRLPRPNTR 59 + G G CER SC SSL CA L ++PRP TR Sbjct: 71 KNGDGKCERKSCG-LQYSSLTQASFCAFPNPPPLLPLLQIPRPETR 115 >At1g23380.2 68414.m02924 homeobox transcription factor (KNAT6) nearly identical to homeodomain transcription factor KNAT6 (KNAT6L) GI:15991302 [Arabidopsis thaliana], homeodomain transcription factor KNAT6 (KNAT6S) [Arabidopsis thaliana] GI:15991300 Length = 326 Score = 26.2 bits (55), Expect = 9.6 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = +1 Query: 175 DELKELMVSALQSEGENVAKLEKADILN*PFAIFTS*DASVACHSTLP 318 DEL + VSAL SE ++A + + N + A +ACH + P Sbjct: 49 DELLSVAVSALSSEAASIAPEIRRNDDNVSLTVI---KAKIACHPSYP 93 >At1g23380.1 68414.m02925 homeobox transcription factor (KNAT6) nearly identical to homeodomain transcription factor KNAT6 (KNAT6L) GI:15991302 [Arabidopsis thaliana], homeodomain transcription factor KNAT6 (KNAT6S) [Arabidopsis thaliana] GI:15991300 Length = 327 Score = 26.2 bits (55), Expect = 9.6 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = +1 Query: 175 DELKELMVSALQSEGENVAKLEKADILN*PFAIFTS*DASVACHSTLP 318 DEL + VSAL SE ++A + + N + A +ACH + P Sbjct: 52 DELLSVAVSALSSEAASIAPEIRRNDDNVSLTVI---KAKIACHPSYP 96 >At1g16480.1 68414.m01971 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 905 Score = 26.2 bits (55), Expect = 9.6 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = -2 Query: 219 SFRL*SADHQLLEFVEAAVDASAPLALKHRFHHFAI-LISARDW 91 + R+ S H + +FV + L ++RFHHF L S +D+ Sbjct: 861 NLRICSDCHSVYKFVSRVIGRRIVLRDQYRFHHFERGLCSCKDY 904 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,948,660 Number of Sequences: 28952 Number of extensions: 154295 Number of successful extensions: 539 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 519 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 539 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 685039728 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -