BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20909 (366 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36777| Best HMM Match : VWA (HMM E-Value=0) 26 8.1 SB_30985| Best HMM Match : DUF1450 (HMM E-Value=1.5) 26 8.1 >SB_36777| Best HMM Match : VWA (HMM E-Value=0) Length = 1303 Score = 26.2 bits (55), Expect = 8.1 Identities = 14/43 (32%), Positives = 24/43 (55%) Frame = -2 Query: 275 GSGLCQLALDGRVRALVSLFSRRIKTLDLDITLCSRHQPTGHF 147 GSG C L +DG+V A ++ ++ + T I + +R T +F Sbjct: 1182 GSGSCTLYIDGKVVASANIGTKTLAT-QYPIRMGARKGDTSYF 1223 >SB_30985| Best HMM Match : DUF1450 (HMM E-Value=1.5) Length = 599 Score = 26.2 bits (55), Expect = 8.1 Identities = 8/18 (44%), Positives = 14/18 (77%) Frame = -3 Query: 196 SIWISPCALVTNLPVTSV 143 ++W+ PC+ V N+ VTS+ Sbjct: 121 ALWLLPCSKVNNVAVTSI 138 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,477,241 Number of Sequences: 59808 Number of extensions: 190234 Number of successful extensions: 383 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 329 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 383 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 582596255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -