BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20908 (552 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z49889-6|CAA90069.2| 435|Caenorhabditis elegans Hypothetical pr... 27 6.8 Z49887-7|CAA90060.2| 435|Caenorhabditis elegans Hypothetical pr... 27 6.8 >Z49889-6|CAA90069.2| 435|Caenorhabditis elegans Hypothetical protein T06H11.4 protein. Length = 435 Score = 27.5 bits (58), Expect = 6.8 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 4/65 (6%) Frame = -2 Query: 368 TALARICVSSVVRFD---PVSSPTS*GYAEIASQGSQLR*EKKVWMVRLVVDGAL-IHKC 201 +AL R+ V + PV++ T GYA IA G L+ V + + GA+ I KC Sbjct: 42 SALGRVVAEEVKSSEDMPPVAASTKDGYAVIAHDGIGLKKMVGVSLAGNIYQGAVEIGKC 101 Query: 200 INADT 186 + T Sbjct: 102 VRIST 106 >Z49887-7|CAA90060.2| 435|Caenorhabditis elegans Hypothetical protein T06H11.4 protein. Length = 435 Score = 27.5 bits (58), Expect = 6.8 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 4/65 (6%) Frame = -2 Query: 368 TALARICVSSVVRFD---PVSSPTS*GYAEIASQGSQLR*EKKVWMVRLVVDGAL-IHKC 201 +AL R+ V + PV++ T GYA IA G L+ V + + GA+ I KC Sbjct: 42 SALGRVVAEEVKSSEDMPPVAASTKDGYAVIAHDGIGLKKMVGVSLAGNIYQGAVEIGKC 101 Query: 200 INADT 186 + T Sbjct: 102 VRIST 106 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,577,901 Number of Sequences: 27780 Number of extensions: 182150 Number of successful extensions: 199 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 199 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 199 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1123720628 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -