BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20902 (524 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50521| Best HMM Match : MFS_1 (HMM E-Value=0.0026) 29 1.8 SB_42841| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_14795| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_31789| Best HMM Match : Ion_trans (HMM E-Value=6.3e-37) 27 7.2 SB_13949| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 >SB_50521| Best HMM Match : MFS_1 (HMM E-Value=0.0026) Length = 1080 Score = 29.5 bits (63), Expect = 1.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -3 Query: 387 CDRKQADHDDPPLCLWESLEYLRMVFLPRLLYFLLVNPLSNT 262 C+R +HDD P C+ +S E+ P L Y L LS T Sbjct: 394 CERDSTEHDDSPRCVRDSKEHEADTSSP-LPYLSLREKLSTT 434 >SB_42841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1651 Score = 29.1 bits (62), Expect = 2.3 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = +3 Query: 330 PNFPISTVEGHHGQLVFGHIEGVSVVAMQGRFHYYEGYPLW 452 PN IS VE +G++VF + G +V ++ F+YY +W Sbjct: 1321 PNEFIS-VELVNGKIVFKYDTGAGLVRVESNFNYYSAGGVW 1360 >SB_14795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 28.3 bits (60), Expect = 4.1 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = +1 Query: 166 YSYETLVETANFLLSRISEKPNIGIICGSGWVRIGKRV 279 + Y+ + + ++ S +P IG+ICGSG +G V Sbjct: 6 HKYDEVDAICQNIRNQTSYQPTIGVICGSGLSSLGDLV 43 Score = 28.3 bits (60), Expect = 4.1 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +3 Query: 279 SLAESIADGVRIPYEDIPNFPIST 350 SL + + + IPYE IP FP ST Sbjct: 38 SLGDLVTEKTVIPYEKIPQFPRST 61 >SB_31789| Best HMM Match : Ion_trans (HMM E-Value=6.3e-37) Length = 583 Score = 27.5 bits (58), Expect = 7.2 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = +1 Query: 64 APINANDIVEK-NCLVTQKVLPEIGSDCNGNEKTGYSYETLVETANFLLSRI 216 A INAN+I + CL T G C+G+E S +TLV ++ ++RI Sbjct: 519 ATINANNICDPPRCLGTSNGSAMAG--CHGDEGLSSSGDTLVPSSKECIARI 568 >SB_13949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 867 Score = 27.5 bits (58), Expect = 7.2 Identities = 15/55 (27%), Positives = 24/55 (43%) Frame = +1 Query: 82 DIVEKNCLVTQKVLPEIGSDCNGNEKTGYSYETLVETANFLLSRISEKPNIGIIC 246 D +EK + E + + K + E +VETA FL+ + I I+C Sbjct: 588 DCMEKTMFLINHTRKESTRKTSHSYKNDFEAEQIVETAKFLIQNGVKPEEITILC 642 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,790,716 Number of Sequences: 59808 Number of extensions: 369677 Number of successful extensions: 772 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 747 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 772 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1184975377 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -