BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20898 (609 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292377-1|CAL23189.2| 358|Tribolium castaneum gustatory recept... 23 2.7 AM292342-1|CAL23154.2| 386|Tribolium castaneum gustatory recept... 23 2.7 AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory recept... 22 3.5 DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 21 8.1 >AM292377-1|CAL23189.2| 358|Tribolium castaneum gustatory receptor candidate 56 protein. Length = 358 Score = 22.6 bits (46), Expect = 2.7 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = -2 Query: 260 SIQYQVLPKL*SF*CH*LQQHLFHYLNTLSLVLCCFSIVY 141 ++ Y + L SF LQQ L ++ S +L C S+++ Sbjct: 67 ALTYHAIFDLISFKDSDLQQKLRYFEEVFSSLLSCCSVIF 106 >AM292342-1|CAL23154.2| 386|Tribolium castaneum gustatory receptor candidate 21 protein. Length = 386 Score = 22.6 bits (46), Expect = 2.7 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = -2 Query: 260 SIQYQVLPKL*SF*CH*LQQHLFHYLNTLSLVLCCFSIVY 141 ++ Y + L SF LQQ L ++ S +L C S+++ Sbjct: 67 ALTYHAIFDLISFKDSDLQQKLRYFEEVFSSLLSCCSVIF 106 >AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory receptor candidate 53 protein. Length = 659 Score = 22.2 bits (45), Expect = 3.5 Identities = 6/20 (30%), Positives = 13/20 (65%) Frame = -1 Query: 390 WTKWVIYSFKFIISECYNLI 331 W+ + I + +I ++CYN + Sbjct: 275 WSAFFIVNVLYICNQCYNTV 294 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 21.0 bits (42), Expect = 8.1 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +2 Query: 194 TNAVVTSDTKTTKVLVKPDT 253 T + T T TTK KP T Sbjct: 164 TTSTTTRTTLTTKFTTKPST 183 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,096 Number of Sequences: 336 Number of extensions: 2947 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15457268 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -