BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20898 (609 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ182016-1|ABA56308.1| 353|Anopheles gambiae G(alpha)i protein. 25 1.4 AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein ... 23 7.7 >DQ182016-1|ABA56308.1| 353|Anopheles gambiae G(alpha)i protein. Length = 353 Score = 25.4 bits (53), Expect = 1.4 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +1 Query: 430 LCKEKWFLKNCSFLFPNEKSI 492 +C KWF++ LF N+K + Sbjct: 252 ICNSKWFVETSIILFLNKKDL 272 >AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein protein. Length = 699 Score = 23.0 bits (47), Expect = 7.7 Identities = 10/32 (31%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = -3 Query: 247 RFYQN-FSRFSVTSYNSICFIT*IHFLWFYVA 155 +F+QN F S+ CF+ F+++Y A Sbjct: 551 QFFQNVIFYFGTASFAIPCFVVLTFFIYYYYA 582 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 574,300 Number of Sequences: 2352 Number of extensions: 11336 Number of successful extensions: 10 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 59291487 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -