BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20879 (568 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bomb... 35 1.2 UniRef50_Q8I5I2 Cluster: Putative uncharacterized protein; n=3; ... 33 6.2 >UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bombyx mori (Silk moth) Length = 782 Score = 35.1 bits (77), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 139 WYLPVRTHKRSYHQ 180 WYLP RTHKRSYH+ Sbjct: 572 WYLPARTHKRSYHR 585 >UniRef50_Q8I5I2 Cluster: Putative uncharacterized protein; n=3; Plasmodium|Rep: Putative uncharacterized protein - Plasmodium falciparum (isolate 3D7) Length = 4494 Score = 32.7 bits (71), Expect = 6.2 Identities = 18/61 (29%), Positives = 34/61 (55%), Gaps = 3/61 (4%) Frame = +1 Query: 295 PVNFVLKVIHTFFL*F**RLYFKVLSLIKFVRL---LVSLYYKDYFLIL*T*FHLYFILD 465 PV +++VI+ F L + L+ K ++ + ++++ LV Y D F +L + FH Y + Sbjct: 3370 PVIQIIRVIYLFSLKYFPTLFLKTINYLNYIKVDENLVQFLYADDFEVLDSLFHKYSLSK 3429 Query: 466 Y 468 Y Sbjct: 3430 Y 3430 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 478,651,437 Number of Sequences: 1657284 Number of extensions: 8807661 Number of successful extensions: 18380 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18008 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18378 length of database: 575,637,011 effective HSP length: 96 effective length of database: 416,537,747 effective search space used: 38321472724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -