BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20879 (568 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0629 - 4582045-4582140,4582218-4582480,4582584-4582704,458... 28 6.0 09_02_0257 + 6355876-6356444,6356690-6357136,6357231-6359166 27 7.9 >06_01_0629 - 4582045-4582140,4582218-4582480,4582584-4582704, 4582833-4583171,4583208-4583245,4583355-4583670, 4583753-4584006,4586417-4586546 Length = 518 Score = 27.9 bits (59), Expect = 6.0 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = +3 Query: 231 LCIVSSCHCEEKIEDIFLKLSTRKFCFESNTYFFFMILV 347 + +++ E KIE +FLK T++ F + +F F LV Sbjct: 160 MLVLAKNESESKIEWVFLKPLTKELWFATVIFFLFTALV 198 >09_02_0257 + 6355876-6356444,6356690-6357136,6357231-6359166 Length = 983 Score = 27.5 bits (58), Expect = 7.9 Identities = 18/54 (33%), Positives = 25/54 (46%) Frame = -1 Query: 286 LRKMSSIFSSQWQDETMQSNKTSDFFIELIFRDRFTGGRTSCESARVGTTALPI 125 LRK + S W + + SDF L R TGGR S E++ + LP+ Sbjct: 152 LRKKWDDWKSDWFYTPSPTKRASDFRASLQRRPP-TGGRRSAEASLIPQGVLPL 204 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,532,342 Number of Sequences: 37544 Number of extensions: 233495 Number of successful extensions: 450 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 444 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 450 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1305140760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -